KEGG   Gallus gallus (chicken): 107055375
Entry
107055375         CDS       T01006                                 

Gene name
TPM4
Definition
(RefSeq) tropomyosin alpha-4 chain isoform X1
  KO
K10375  tropomyosin 4
Organism
gga  Gallus gallus (chicken)
Pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107055375 (TPM4)
   04261 Adrenergic signaling in cardiomyocytes
    107055375 (TPM4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gga04812]
    107055375 (TPM4)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     107055375 (TPM4)
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 Laminin_II CLZ Laminin_I Crescentin ATG16 TMF_DNA_bd ERM CENP-F_leu_zip Mce4_CUP1 HrpB7 DHR10 FPP PspA_IM30 DUF1664 DUF745 AAA_13 Lebercilin ADIP DUF3584 GAS MscS_porin Uds1 DUF3450
Other DBs
NCBI-GeneID: 107055375
NCBI-ProteinID: XP_015155676
CGNC: 78334
Ensembl: ENSGALG00000002563
Position
28
AA seq 284 aa
MEAIKKKMQMLKLDKENAIDRAEQAETDKKAAEDKCKQVEDELVALQKKLKGTEDELDKY
SEALKDAQEKLEQAEKKATDAEGEVAALNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGELERAE
ERAEVSEVKCSDLEEELKNVTNNLKSLEAQSEKYSEKEDKYEEEIKILSDKLKEAETRAE
FAERTVAKLEKSIDDLEDKLAQAKEENLGLHQTLDQTLNELNCI
NT seq 855 nt   +upstreamnt  +downstreamnt
atggaagctatcaagaaaaagatgcagatgttgaagctggacaaggagaatgcaattgat
agagcagagcaggctgaaacggataagaaggcagctgaggacaaatgcaaacaggtcgag
gatgagctggtagctctgcagaagaagttgaaaggaactgaagatgagctggataaatac
tctgaggctctgaaagatgcccaggaaaagctggagcaggctgaaaagaaggccacggat
gcagaaggtgaggtggcggcgctcaacagacgcatccagctggtggaagaggagctggat
cgggcccaggagcggctggccacagccctgcagaagctggaagaggccgaaaaagcggcg
gatgagagtgagagaggaatgaaagtcattgagaacagagcaatgaaagatgaagaaaaa
atggaaattcaggaaatgcagctgaaggaggccaagcacatcgctgaggaggccgaccgc
aaatacgaagaggttgcccgcaagttggtgattttggagggggagctggaaagagctgaa
gagcgcgcagaggtgtccgaagttaaatgcagtgaccttgaagaggagttgaagaatgtc
acaaacaatctgaagtctttggaagctcaatctgaaaagtactcggaaaaggaagataag
tatgaagaggaaatcaagattctctctgacaagcttaaagaagctgaaactcgtgctgag
tttgctgagagaacagttgccaaactggaaaagtccattgatgatctggaagacaaactt
gctcaagcaaaggaggagaacctggggctgcaccagacgctggaccagacgctaaacgaa
ctgaactgtatatga

KEGG   Gallus gallus (chicken): 396366
Entry
396366            CDS       T01006                                 

Gene name
TPM1
Definition
(RefSeq) tropomyosin alpha-1 chain
  KO
K10373  tropomyosin 1
Organism
gga  Gallus gallus (chicken)
Pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    396366 (TPM1)
   04261 Adrenergic signaling in cardiomyocytes
    396366 (TPM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gga04812]
    396366 (TPM1)
   04147 Exosome [BR:gga04147]
    396366 (TPM1)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     396366 (TPM1)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   396366 (TPM1)
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 CLZ Laminin_II TMF_DNA_bd Crescentin ERM DUF745 CENP-F_leu_zip Fib_alpha ATG16 XhlA HrpB7 GAS
Other DBs
NCBI-GeneID: 396366
NCBI-ProteinID: NP_990732
CGNC: 49772
Ensembl: ENSGALG00000003521
UniProt: P04268
Structure
PDB: 
1IC2

Position
10
AA seq 284 aa
MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEERSKQLEDELVALQKKLKGTEDELDKY
SESLKDAQEKLELADKKATDAESEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIENRAQKDEEKMEIQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERAE
ERAELSESQVRQLEEQLRIMDQTLKALMAAEDKYSQKEDKYEEEIKVLTDKLKEAETRAE
FAERSVTKLEKSIDDLEEKVAHAKEENLNMHQMLDQTLLELNNM
NT seq 855 nt   +upstreamnt  +downstreamnt
atggatgccatcaagaaaaagatgcagatgctgaaactggacaaggagaatgccttggac
agagccgagcaagccgaagcggacaagaaggcagcggaggagaggagcaagcagctggag
gacgagctggtggctctgcaaaagaagctgaagggcactgaggatgagctggacaaatac
tccgagtcccttaaagatgcacaggaaaagttggaactggctgacaaaaaggccacagat
gctgagagtgaagtagcttccctgaacagacgcatccaactggttgaggaagagttggat
cgggctcaggagcgcttggctactgccctgcagaagctggaggaggctgagaaggctgca
gatgagagtgaaagaggaatgaaggtcattgaaaatagagcccagaaggatgaagagaag
atggaaatccaagagatccagcttaaagaagctaagcacattgctgaagaggctgaccgc
aagtatgaagaggtggctcgtaagctcgtgatcattgagggtgacctggagcgggctgag
gagcgtgctgaactatcagaaagccaagtccgacagctggaagaacagttaagaataatg
gatcaaaccttgaaagcattaatggctgcagaggataagtactcgcagaaagaagacaaa
tatgaagaggagattaaagttctaactgacaaactgaaggaggctgagacccgtgctgaa
tttgctgagaggtcagtaaccaagctggagaagagcattgatgatctagaagagaaagtg
gcgcatgccaaagaagaaaaccttaatatgcatcagatgctggatcaaactttactggag
ttaaacaacatgtga

KEGG   Gallus gallus (chicken): 396430
Entry
396430            CDS       T01006                                 

Gene name
TPM2
Definition
(RefSeq) tropomyosin beta chain
  KO
K09290  tropomyosin 3
Organism
gga  Gallus gallus (chicken)
Pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    396430 (TPM2)
   04261 Adrenergic signaling in cardiomyocytes
    396430 (TPM2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gga04812]
    396430 (TPM2)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     396430 (TPM2)
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 HrpB7 Laminin_II DHR10 TMF_DNA_bd DUF16 YscO Crescentin SlyX HR1 Fib_alpha CENP-F_leu_zip MscS_porin XhlA DUF1664 ERM Lebercilin FPP CLZ
Other DBs
NCBI-GeneID: 396430
NCBI-ProteinID: NP_990777
CGNC: 49799
Ensembl: ENSGALG00000025842
UniProt: Q05705
Position
Z
AA seq 248 aa
MAGISSIDAVKKKIQSLQQVADEAEERAEHLQREADAERQARERAEAEVASLNRRIQLVE
EELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMELQEMQLKEAKHIAE
EADRKYEEVARKLVVLEGELERSEERAEVAESRVRQLEEELRTMDQSLKSLIASEEEYST
KEDKYEEEIKLLGEKLKEAETRAEFAERSVAKLEKTIDDLEDEVYAQKMKYKAISEELDN
ALNDITSL
NT seq 747 nt   +upstreamnt  +downstreamnt
atggccggcatcagctccatcgatgccgtcaagaagaagatccagagcctgcagcaggtg
gctgacgaggcggaggaacgcgccgagcacctgcagcgggaggccgatgccgagcggcag
gcccgggagcgggccgaggccgaggtggcttctctgaaccgccgcatccagctggtggag
gaggagctggaccgggcccaggagcgcctggccaccgccctgcagaagctggaagaggct
gagaaggcggcggatgagagcgagagaggcatgaaggtcattgagaacagggccatgaag
gatgaggagaaaatggaactccaggaaatgcaactgaaggaggccaaacacatagcggaa
gaggccgaccgcaaatatgaggaggtggcccgcaagctggtggtccttgagggagagctg
gagcgctcagaggagcgagcagaggtcgcggagagccgagtgagacagctggaggaggag
ctgcggaccatggaccagagcctcaaatccctcattgcctcagaggaagagtattccacc
aaggaggacaagtacgaggaggaaatcaagcttctaggggagaaactgaaggaggctgag
accagggcagagtttgctgagcggtctgtggcaaagctggagaaaaccattgatgactta
gaagacgaagtgtatgcacagaagatgaagtacaaagccatcagcgaggagctggacaat
gcgcttaacgacatcacctccctctga

KEGG   Gallus gallus (chicken): 770103
Entry
770103            CDS       T01006                                 

Gene name
TPM3
Definition
(RefSeq) tropomyosin alpha-3 chain isoform a
  KO
K09290  tropomyosin 3
Organism
gga  Gallus gallus (chicken)
Pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    770103 (TPM3)
   04261 Adrenergic signaling in cardiomyocytes
    770103 (TPM3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gga04812]
    770103 (TPM3)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     770103 (TPM3)
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 Laminin_II TMF_DNA_bd CENP-F_leu_zip DUF745 Lebercilin Crescentin XhlA DUF3450 DUF16 DUF1664 MscS_porin Golgin_A5 CALCOCO1 SlyX ERM WES_acyltransf EzrA DHR10 BORCS7 Fib_alpha
Other DBs
NCBI-GeneID: 770103
NCBI-ProteinID: NP_001232856
CGNC: 55775
Ensembl: ENSGALG00000013537
UniProt: Q5ZLJ7
Position
25
AA seq 248 aa
MAGATTIEAVKRKIQVLQQQADDAEERADRLQREVEAERRNREQAEAEVASLNRRIQLVE
EELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAE
EADRKYEEVARKLVIIEGDLERTEERAELAESKCSELEEELKNVTNNLKSLEAQAEKYSQ
KEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDH
ALNDMTSI
NT seq 747 nt   +upstreamnt  +downstreamnt
atggcgggggccaccacgatcgaggcggtgaagcgcaagattcaggtgctgcagcagcag
gcggacgacgccgaggagcgggcggaccgcctgcagcgggaggtggaggccgagcgccgt
aaccgcgagcaggctgaggcagaggtggcatccctgaaccgccgcatccagctggtagag
gaggagctggaccgggcccaggagcgcctcgccaccgctctgcagaagctggaggaggct
gagaaggctgcggatgaaagcgaaagaggcatgaaagtcattgaaaacagagctctgaag
gatgaggagaagatggagctgcaggagatccagctgaaggaagccaagcacattgcagag
gaggcggacaggaagtatgaggaggttgctcggaaactggtgatcatagagggagacctg
gagcgtactgaggagagagctgagcttgcagagtctaaatgttccgagctggaggaggag
ctgaagaatgtcaccaacaatctcaagtctcttgaggctcaggctgagaagtactcccaa
aaagaggataaatacgaagaggagatcaagatcctgactgataaactcaaagaggcggag
acccgtgctgagttcgctgagcgctctgtagccaagctggagaagaccatcgatgatttg
gaagatgagctctatgcccagaaactgaagtacaaagcaattagtgaggaactggaccac
gccctgaatgacatgacttccatataa

DBGET integrated database retrieval system