KEGG   Gallus gallus (chicken): 373890
Entry
373890            CDS       T01006                                 

Gene name
ADRA1B
Definition
(RefSeq) alpha-1B adrenergic receptor isoform X1
  KO
K04136  adrenergic receptor alpha-1B
Organism
gga  Gallus gallus (chicken)
Pathway
gga04020  Calcium signaling pathway
gga04080  Neuroactive ligand-receptor interaction
gga04261  Adrenergic signaling in cardiomyocytes
gga04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    373890 (ADRA1B)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    373890 (ADRA1B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    373890 (ADRA1B)
   04270 Vascular smooth muscle contraction
    373890 (ADRA1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:gga04030]
    373890 (ADRA1B)
G protein-coupled receptors [BR:gga04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    373890 (ADRA1B)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 373890
NCBI-ProteinID: XP_004944873
CGNC: 48942
Ensembl: ENSGALG00000001416
Position
13
AA seq 411 aa
MSTYLAEKSNSSILGYLKVSALNSGNLSANSSNETTSNLDSPTLDISRAITVGLILGAFI
LFAIIGNILVILSVACNRHLRIPTNYFIINLAIADLLLSFTVLPFSATLEILGYWVLGRI
FCDIWAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRRAILALLGVWVLSMVI
SIGPLLGWKEPAPKDDKECRITEEPFYALFSSLGSFYIPLIVILVMYCRVYIVAKRTTKN
LEAGVMKEMSNSKELTLRIHYRNIHEDTLNSNKSKGHNSRNSLALKLLKFSREKKAAKTL
GIVVGMFILCWLPFFIVLPLGALDCSNYNLLTHQCRATNYNISSASDSRLDIYLHCSGRL
LPQPVFFMPYVYKKKNQPKSYIHICIFKICALFHSVMQWLHNGVSRVALDF
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgagtacctaccttgctgagaaatccaattcatcaatacttggatatttgaaagtgtct
gcattaaatagtggcaatctttctgcaaacagctccaatgagacaacaagcaacctggat
tcgcctaccttggatatcagtagggcgataactgtggggctcatcctaggtgcctttata
ctctttgctattataggtaatattttggtaattctctctgttgcttgcaatagacattta
agaatccctacaaactatttcataattaaccttgcaatagcagatttgttgctgagtttt
actgtccttccattctctgctacactggaaatccttggctactgggttctggggaggata
ttctgtgatatctgggcagcagttgacgtgctctgctgtacagcttctattttaagtcta
tgtgcaatctccatagatagatatataggagtacgttattctctccagtatccaactttg
gtaacaagaagaagagcaattctagctctcctgggtgtctgggtcctttccatggtaatt
tctattgggcctcttttgggctggaaagaaccagcacccaaggatgacaaagagtgccgt
atcactgaagaaccattctatgctttgttttcttccttgggatcattttacattccttta
atcgtcatccttgtgatgtactgtcgggtctacatagtggccaaaaggactacaaaaaat
ctggaagctggtgttatgaaagaaatgtccaactccaaggagctgacgttacggatccat
tacaggaacattcatgaggacaccttaaacagcaacaaatccaagggtcacaattccaga
aactccttagctctcaaacttttaaagttctctagagaaaagaaggcagccaagacactg
ggaattgtggttggcatgtttatcctgtgctggctacctttcttcattgttctgccacta
ggtgccctggactgctccaattacaatctactcacccatcaatgcagagctacaaactac
aatatctcttctgcttctgactccagactagatatttatcttcactgcagtggaaggctt
cttcctcagcctgtattttttatgccttatgtctacaaaaaaaaaaaccaacctaaatca
tacattcacatctgcatctttaaaatttgtgccttgtttcactcagtaatgcaatggctg
cacaatggtgttagcagagtagctctggacttctga

KEGG   Gallus gallus (chicken): 422933
Entry
422933            CDS       T01006                                 

Gene name
ADRA1D
Definition
(RefSeq) alpha-1D adrenergic receptor
  KO
K04137  adrenergic receptor alpha-1D
Organism
gga  Gallus gallus (chicken)
Pathway
gga04020  Calcium signaling pathway
gga04080  Neuroactive ligand-receptor interaction
gga04261  Adrenergic signaling in cardiomyocytes
gga04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    422933 (ADRA1D)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    422933 (ADRA1D)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    422933 (ADRA1D)
   04270 Vascular smooth muscle contraction
    422933 (ADRA1D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:gga04030]
    422933 (ADRA1D)
G protein-coupled receptors [BR:gga04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    422933 (ADRA1D)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 422933
NCBI-ProteinID: XP_004936331
CGNC: 11925
Ensembl: ENSGALG00000038787
UniProt: A0A1D5PRZ3
Position
4
AA seq 511 aa
MTFPELSNGSLSENRTGQGSQSGANRSWGLQGEESPEGNGTTLPFALDVQAVGVGVFLAV
FILSAIVGNILVILSVACNRHLQTVTNYFIVNLAIADLLLSTTVLPFSATLEVLGFWVFG
RIFCNIWAAVDVLCCSASIMSLCIISVDRYIGVKYSLKYPTIMTERKAGVILVVVWLSSM
VISIGPLLGWKEPPPPDESICSITEEPGYALFSSLFSFYLPLMVILVMYFRIYVVARRTT
RSLEAGVKKERNKSMEVVLRIHCRSVLEEPLSSTQSKGHNFRSSLSVRLLKFSREKKAAK
TLAIVVGVFILCWFPFFFVLPFGSFFPSLKPSEMVFKVIFWLGYFNSCVNPIIYPCSSKE
FKRAFIRLLKCQCHRRRRPIWRVYDHHWRGASVNSSVQDSETDLRPRISTLNSSFIFNSS
LQERAGKRRTLSFKGWKMLTPFQKPASAQLKEKMNSLSNKIRGGSSKGGVTATYKTEVES
VSIGIPHDFMETIDYQTYDLTDCCGLRETDI
NT seq 1536 nt   +upstreamnt  +downstreamnt
atgactttccctgagctgagcaatggcagcttgagtgagaacaggacgggacagggcagc
cagagcggtgccaaccggtcctgggggttgcaaggcgaggagtcccccgaaggcaacggc
accacgctgccattcgccttggacgtgcaggcggtgggcgtcggggtcttcttggctgtc
ttcatcctctcggccatcgtgggcaacatcctcgtcatcctgtcggtggcttgcaaccgg
cacctgcagacagtcaccaactacttcatcgtcaacctggccatcgccgacctgctgctc
agcaccaccgtgctgcccttctcggccaccttggaggtgttgggtttttgggtttttggc
cgcatcttctgcaacatctgggcagcggtggatgtgctgtgctgctccgcctccatcatg
agcttgtgcatcatctccgtggacaggtatatcggcgtcaagtattccctcaagtatccc
accatcatgacagagaggaaggctggggtcatcctggtggtggtctggctctcctccatg
gtcatctccattgggccgctgctggggtggaaggaaccaccgccaccagatgagagcatc
tgtagcatcactgaggagccaggctatgccctgttctcttcccttttctccttttacctg
cccctcatggtcatcctggtgatgtacttcaggatctacgtggtggccaggaggacaacc
cggagcttggaggcgggggtcaagaaggagaggaataaatccatggaggtggtgctgcgc
atccactgccgcagtgtgctggaggagcctctctccagcacccagagcaaagggcacaac
ttcaggagctccctctccgtgcggctcctcaagttctcccgtgagaaaaaagcagccaag
actcttgccatcgttgtgggcgtcttcatcctctgttggttccccttcttcttcgtcctg
ccttttggttctttcttcccatctctgaagccctcagaaatggtcttcaaggtcatcttc
tggctgggatacttcaacagctgcgtgaaccccatcatctacccctgctccagcaaggag
ttcaagcgagcgttcatcaggctactcaagtgccaatgtcaccgcagaagaaggcccatc
tggcgtgtctacgaccaccactggcgaggggcctcagtgaacagctctgtgcaggactcc
gagacggacctgaggcccaggattagcaccctgaacagctccttcatatttaactcctcc
ttgcaggagagagctggcaagaggcgaacactcagcttcaagggttggaaaatgctcact
cctttccagaaaccagcatccgcccagctgaaagagaagatgaacagcctttctaacaaa
atccggggagggtccagcaaaggaggggtgacagccacctacaagacagaggtggagtct
gtctcaattgggatccctcatgactttatggaaaccattgactatcaaacctatgattta
acagactgctgtgggctgagagaaacggatatttga

KEGG   Gallus gallus (chicken): 428203
Entry
428203            CDS       T01006                                 

Gene name
ADRA1A
Definition
(RefSeq) alpha-1A adrenergic receptor
  KO
K04135  adrenergic receptor alpha-1A
Organism
gga  Gallus gallus (chicken)
Pathway
gga04020  Calcium signaling pathway
gga04080  Neuroactive ligand-receptor interaction
gga04261  Adrenergic signaling in cardiomyocytes
gga04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    428203 (ADRA1A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    428203 (ADRA1A)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    428203 (ADRA1A)
   04270 Vascular smooth muscle contraction
    428203 (ADRA1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:gga04030]
    428203 (ADRA1A)
G protein-coupled receptors [BR:gga04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    428203 (ADRA1A)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv 7tm_4
Other DBs
NCBI-GeneID: 428203
NCBI-ProteinID: XP_015152983
CGNC: 53293
Ensembl: ENSGALG00000000469
UniProt: F1NP52
Position
22
AA seq 467 aa
MVFLPGNSSNCSNCTYSAEPVNISKAILLGVILGGLIIFGVLGNILVILSVACHRHLQSV
THYYIINLAVADLLLTSTVLPFSATMEILGYWAFGRIFCNIWAAVDVLCCTASIMSLCII
SIDRYIGVSYPLRYPSIVTEKRGLLALLCVWALSLVISIGPLFGWKEPAPEDETICQITE
EPGYVLFSALGSFYLPLTIILVMYCRVYVVAKRENKGLRSGLKMEKSRSEAVTLRIHRKN
VPENSGATASSKSKHHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFVVMPLGSFFPT
IKPPDTLFKITFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRAQCLPRKHAAKKQSPSFN
LNHPSNQSMGGGKGVVRIPVGSGETFYKISKSDGVCEWKIFSAVQSVPTKSAIPKDKSSC
TAAKVKSKGFLQECCCAGTSGNTVHENCKVPTIKIHTMSLSESGEDV
NT seq 1404 nt   +upstreamnt  +downstreamnt
atggttttcctccctgggaactcatccaactgttccaactgcacctactctgcagagccc
gtgaacatttccaaggccattttgctgggtgtcattctaggggggttgatcatttttggg
gttttgggtaacattctggttatcctctctgtagcctgtcacaggcatcttcagagtgtc
acccactactatataattaacctggctgtagccgacctcctcttgacatccactgtcctg
cccttctcagctactatggagattttgggctactgggcctttgggaggatcttctgcaac
atctgggcagccgttgacgtcctttgctgcactgcatccattatgagcctctgcatcatc
tcgatagacagatacatcggggtgagctacccactgcggtaccccagcatagtgacggag
aagagaggcctcctggctctgttgtgcgtgtgggcgctgtctctagtcatctccattgga
cctctttttggatggaaggaaccagcacccgaagatgagaccatctgccagatcaccgaa
gagcccggctatgtgctgttctccgcgctgggctccttctacctccccctgaccatcatc
ctggtgatgtactgccgagtgtacgtcgtggccaaaagggaaaacaaaggtttgaggtcg
gggctgaagatggagaaatctcgttccgaagcagtcaccctacggatccaccgcaaaaac
gttcccgaaaacagcggggccacggccagctctaagagcaaacatcacttctcggtgcgt
ctcctcaagttctccagggaaaagaaagcagccaagaccctgggaattgttgtgggatgc
tttgttctgtgctggcttcctttttttgtagtcatgcctcttggttctttctttcctaca
atcaaacccccggacacactttttaaaataacattctggcttggatatttaaacagctgc
atcaaccccatcatctatccatgctccagtcaagagtttaagaaagcgttccaaaatgtc
ctgagagcgcagtgcctcccaagaaagcacgcagcaaagaagcaatccccaagcttcaac
ctcaaccatcccagcaaccaaagcatgggaggtggcaaaggcgtagtccgtatccccgtc
ggctcaggggaaaccttctataagatttccaaatccgatggggtctgcgaatggaagata
ttctccgccgtgcaaagcgtgccgacaaaaagtgcgattcctaaggacaagtccagctgt
actgctgccaaagtgaaaagcaaaggtttcctccaggagtgctgctgtgcgggcacttcg
gggaacacggtccatgaaaactgcaaagtgccgaccattaaaatacacaccatgtccctc
agtgagagcggggaggatgtctaa

DBGET integrated database retrieval system