KEGG   Gallus gallus (chicken): 374097
Entry
374097            CDS       T01006                                 

Gene name
GNAI3
Definition
(RefSeq) guanine nucleotide-binding protein G(k) subunit alpha
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
gga  Gallus gallus (chicken)
Pathway
gga04261  Adrenergic signaling in cardiomyocytes
gga04371  Apelin signaling pathway
gga04540  Gap junction
gga04914  Progesterone-mediated oocyte maturation
gga04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    374097 (GNAI3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    374097 (GNAI3)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    374097 (GNAI3)
   04916 Melanogenesis
    374097 (GNAI3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    374097 (GNAI3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    374097 (GNAI3)
   04031 GTP-binding proteins [BR:gga04031]
    374097 (GNAI3)
Exosome [BR:gga04147]
 Exosomal proteins
  Proteins found in most exosomes
   374097 (GNAI3)
GTP-binding proteins [BR:gga04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    374097 (GNAI3)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_29
Other DBs
NCBI-GeneID: 374097
NCBI-ProteinID: NP_989580
CGNC: 18
Ensembl: ENSGALG00000041700
UniProt: Q90846
Position
26
AA seq 354 aa
MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEEECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGEVARADDARQLFVLAGSAEEGVMT
AELAGVIKRLWRDAGVQACFSRSREYQLNDSASYYLNDLDRISQPTYIPTQQDVLRTRVK
TTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYTGSNTYEEAA
AYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKECGLY
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggatgtaccctgagcgccgaggagcgggccgccctggagcgcagcaaggccatcgag
aagaacctgaaggaggacggcatcagcgcggccaaagacgtgaagctgctcctgctcggg
gccggcgagtcggggaagagcaccatcgtgaagcagatgaagattattcacgaggacggc
tactcggaggaagaatgcaaacaatataaagtggttgtctacagcaatactatccagtcc
atcattgccatcataagagccatgggaaggctaaagatagactttggggaagttgccaga
gcagacgatgcccgccagctgttcgtgttggctggaagtgcagaagagggggtgatgacg
gccgagctggctggagtgatcaagcggctgtggcgggatgctggggtgcaggcctgcttc
agcagatccagggagtaccagctgaacgactccgcctcatattacctgaacgacttggat
agaatatcccagccgacctacattccgactcagcaggacgtgctgcgcaccagggtgaaa
accacgggcatcgtggagacacacttcaccttcaaggacctctacttcaagatgtttgat
gtcggtgggcagcggtcggagcggaagaagtggatccactgcttcgaaggcgtcacagcg
atcatcttctgtgtggccctcagcgattatgaccttgtcttggccgaggatgaagaaatg
aaccggatgcacgagagcatgaaactgtttgacagcatctgtaacaacaaatggttcaca
gacacgtccatcattcttttcctgaacaagaaggacctgtttgaggaaaagattaagaag
agcccactgacgatctgctacccggagtacacaggctccaacacgtacgaggaggcggct
gcctacatccagtgtcagtttgaggacctgaaccggaggaaagacaccaaggagatctac
acgcacttcacctgcgccaccgacaccaagaacgtgcagttcgtgttcgacgccgtgacg
gacgtcatcattaagaacaacctgaaggagtgtgggctctactga

KEGG   Gallus gallus (chicken): 396367
Entry
396367            CDS       T01006                                 

Gene name
GNAI2
Definition
(RefSeq) guanine nucleotide-binding protein G(i) subunit alpha-2
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
gga  Gallus gallus (chicken)
Pathway
gga04261  Adrenergic signaling in cardiomyocytes
gga04371  Apelin signaling pathway
gga04540  Gap junction
gga04914  Progesterone-mediated oocyte maturation
gga04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    396367 (GNAI2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    396367 (GNAI2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    396367 (GNAI2)
   04916 Melanogenesis
    396367 (GNAI2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    396367 (GNAI2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    396367 (GNAI2)
   04031 GTP-binding proteins [BR:gga04031]
    396367 (GNAI2)
Exosome [BR:gga04147]
 Exosomal proteins
  Proteins found in most exosomes
   396367 (GNAI2)
GTP-binding proteins [BR:gga04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    396367 (GNAI2)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc AAA_16 TniB AAA_29
Other DBs
NCBI-GeneID: 396367
NCBI-ProteinID: NP_990733
CGNC: 49773
Ensembl: ENSGALG00000035645
UniProt: P50147
Position
12
AA seq 355 aa
MGCTVSAEDKAAAERSRMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEEECRQYKAVVYSNTIQSIMAIIKAMGNLQIDFGDSSRADDARQLFALACTAEEQGIM
PEDLANVIRRLWADHGVQACFNRSREYQLNDSAAYYLNDLERIARADYIPTQQDVLRTRV
KTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEE
MNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIVHSPLTICFPEYTGANKYDEA
AGYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgggctgcacggtcagcgccgaggataaggcggccgccgagcgctcccgcatgatcgac
cgcaacctgcgggaggacggcgagaaggcggcgcgggaggtgaagctgctgctgctgggt
gctggggagtccgggaagagcaccatcgtcaaacagatgaagatcatccacgaagatggc
tactcggaggaggagtgccggcaatacaaagccgtggtctacagcaacaccatccagtcc
atcatggccatcatcaaggctatggggaacctgcagatcgacttcggggactcctccaga
gcggatgatgcccgccagctctttgcgctcgcctgcaccgcagaggagcagggcatcatg
cctgaagacctcgccaacgtcatccggaggctgtgggctgaccacggggtccaggcctgc
ttcaatcgctcccgtgaataccaactgaatgactctgctgcctactacctgaacgacctg
gagaggatagcgcgggccgactacatccccacccagcaggacgtgctgcgcacccgggtg
aagaccaccggcatcgtggagacccacttcaccttcaaggacctgcacttcaagatgttc
gacgtgggcggccagcgctcagagcggaagaagtggatccactgcttcgagggggtgacg
gccatcatcttctgcgtggccctgagtgcctatgacctggtgctggcagaagatgaggag
atgaaccgaatgcatgagagcatgaagctatttgacagcatctgcaacaacaagtggttc
acggacacgtccatcatcctcttcctcaacaagaaggacctctttgaggagaagatcgtg
cacagccccctgaccatctgcttcccggagtacacaggtgccaacaagtacgacgaggcc
gccggctacatccagagcaagtttgaggacctgaacaagcggaaggacaccaaggagatc
tacacgcacttcacctgtgccaccgacaccaagaacgtgcagtttgtcttcgatgccgtc
accgacgtcatcatcaaaaacaacctgaaggactgcgggctcttctga

KEGG   Gallus gallus (chicken): 396368
Entry
396368            CDS       T01006                                 

Gene name
GNAI1
Definition
(RefSeq) guanine nucleotide-binding protein G(i) subunit alpha-1
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
gga  Gallus gallus (chicken)
Pathway
gga04261  Adrenergic signaling in cardiomyocytes
gga04371  Apelin signaling pathway
gga04540  Gap junction
gga04914  Progesterone-mediated oocyte maturation
gga04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    396368 (GNAI1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    396368 (GNAI1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    396368 (GNAI1)
   04916 Melanogenesis
    396368 (GNAI1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    396368 (GNAI1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    396368 (GNAI1)
   04031 GTP-binding proteins [BR:gga04031]
    396368 (GNAI1)
Exosome [BR:gga04147]
 Exosomal proteins
  Proteins found in most exosomes
   396368 (GNAI1)
GTP-binding proteins [BR:gga04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    396368 (GNAI1)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA TniB AAA_29 FtsK_SpoIIIE AAA_16
Other DBs
NCBI-GeneID: 396368
NCBI-ProteinID: NP_990734
CGNC: 49774
Ensembl: ENSGALG00000008382
UniProt: P50146
Position
1
AA seq 354 aa
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAG
YSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDPTRADDARQLFVLAGAAEEGFMT
ADVAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQTSYIPTQQDVLRTRVK
TTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICYPEYAGSNTYEEAA
AYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggctgcacgctgagcgccgaggacaaggcggcggtggagaggagcaagatgatcgat
aggaacctgcgggaggacggcgagaaggcggccagggaggtgaagctgctcctgctcgga
gctggtgaatcagggaaaagcactattgtcaaacagatgaagattatccatgaagctggt
tattcagaagaagaatgtaaacagtacaaagctgttgtctacagtaacaccattcagtca
attattgctatcattagagcaatggggaggttgaagatagactttggtgatccaaccagg
gctgatgatgctcgtcaactctttgtgttagctggagcagcagaggaaggatttatgact
gcggacgttgctggtgttatcaaaagactgtggaaagacagtggagtacaagcttgtttc
aacagatctagagaataccagcttaatgactctgctgcatattacttgaatgacttggac
aggatagcacaaacaagctacattccgactcaacaagatgttctcaggactagagtgaaa
actacaggaatagtggaaactcactttactttcaaagatcttcattttaaaatgtttgat
gttggaggccaaagatcggagcggaagaagtggattcattgttttgagggtgttacagca
attattttctgtgtggcattaagtgattatgacttggtcttggctgaagatgaggaaatg
aatcggatgcatgaaagcatgaaattgtttgacagtatctgcaacaacaaatggttcaca
gacacttctataattctgttcctaaacaagaaagatctttttgaagaaaaaatcaagagg
agtcctctcactatttgctaccctgaatatgcaggatcgaacacttacgaagaagcagct
gcttacattcagtgtcagtttgaagatcttaacaagagaaaagacacaaaggaaatctac
actcacttcacatgtgccacagatacgaaaaatgtgcagtttgtttttgatgctgtaact
gatgtcattattaaaaataaccttaaagactgtggcctcttctaa

DBGET integrated database retrieval system