KEGG   Gallus gallus (chicken): 374174
Entry
374174            CDS       T01006                                 

Gene name
CAMK2B
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit beta
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04012  ErbB signaling pathway
gga04020  Calcium signaling pathway
gga04114  Oocyte meiosis
gga04217  Necroptosis
gga04261  Adrenergic signaling in cardiomyocytes
gga04310  Wnt signaling pathway
gga04912  GnRH signaling pathway
gga04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    374174 (CAMK2B)
   04310 Wnt signaling pathway
    374174 (CAMK2B)
   04020 Calcium signaling pathway
    374174 (CAMK2B)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    374174 (CAMK2B)
   04217 Necroptosis
    374174 (CAMK2B)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    374174 (CAMK2B)
   04916 Melanogenesis
    374174 (CAMK2B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    374174 (CAMK2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    374174 (CAMK2B)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     374174 (CAMK2B)
Protein kinases [BR:gga01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   374174 (CAMK2B)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 APH SnoaL_2 Pkinase_fungal Kdo TCAD9 SnoaL_4
Other DBs
NCBI-GeneID: 374174
NCBI-ProteinID: NP_989625
CGNC: 49071
UniProt: O93560
Position
22
AA seq 540 aa
MATTVPCTRFTDEYQLYEEIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLER
EARICRLLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDLVAREYYSEADASHCIQQI
LEAVLHCHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPDWDT
VTPEAKNLINQMLTINPAKRITAHEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKL
KGAILTTMLATRNFSVGRQTTAPPSMSAAAAPLGLVEQAKSLLNKKADGVKPQTNSTKGS
AGVTSPKGTLPPAALEPQTTVIHNPADGIKESSDSTNTTIEDEDTKARKQEIIKITEQLI
EAVNNGDFEAYAKICDPGLTSFEPEALGNLVEGMDFHRFYFENLLSKNNKPIHTTILNPH
VHVIGEDAACIAYIRLTQYLDAQGRPRTSQSEETRVWHRRDGKWQNVHFHGSGAPVAPLQ
NT seq 1623 nt   +upstreamnt  +downstreamnt
atggccaccaccgtgccctgcacccgcttcaccgacgagtatcagctctacgaggagatc
ggcaagggggctttctcggtggtccggcgctgcgtcaagctgtgcaccggccatgagtac
gctgccaagatcatcaacaccaagaagctctcagccagagaccaccagaaactggagagg
gaggcgcgcatctgccggctgctgaagcactccaacatcgtgcggctccacgacagcatc
tcggaggagggcttccactacctcgtgttcgacctggtgacgggcggagagctgtttgag
gacctcgtggcccgggagtactacagcgaggcggacgccagccactgcatccagcaaatc
ctggaagccgtcctgcactgtcaccaaatgggggtcgtgcacagagacctcaagccagag
aacctcctcctggccagcaagtgtaagggcgcggcggtgaagctggcggatttcgggctg
gccatcgaggtgcagggtgatcagcaggcctggttcggcttcgccggcacacccggctac
ctgtcccccgaggtgctgcgcaaggaggcctacggcaaacccgtggacatctgggcctgc
ggggtgatcctatacatcctgctggtgggatacccgcccttctgggacgaggaccagcac
aagctgtaccagcagatcaaggcgggcgcctacgacttcccctccccggattgggacacg
gtcacccccgaagccaagaacctcatcaaccagatgctgaccatcaaccctgccaagcgc
atcaccgcccacgaggccctcaagcacccgtgggtctgccaacgctccaccgtggcctcc
atgatgcacagacaggagacggtggagtgcctgaagaagttcaacgcccgcaggaagctg
aagggcgcgatcctcaccaccatgttggccacccggaacttctcagtgggcagacagacc
accgcgcctccctccatgtcggccgccgcggcccccctggggctggtggaacaagctaag
agtctgctcaacaagaaggctgatggcgtcaagccccagaccaacagcaccaaaggtagc
gctggcgtcaccagccccaaagggacactgccgcccgcagcgctggagcctcaaactacc
gtaattcataaccctgcggacggcattaaggagtcgtccgacagcaccaacaccaccatc
gaggacgaggacaccaaagcccgcaagcaggagatcattaagatcacagagcagctcatc
gaggccgtcaacaacggggacttcgaggcctacgcgaaaatctgcgacccggggctcacc
tccttcgagcccgaagcgctgggcaacctggtggagggcatggacttccaccgcttctac
ttcgagaacttgctgtccaagaacaacaaaccgatccacacgaccatcctgaacccccac
gtccacgtcatcggggaggacgcggcgtgcatcgcctacatccgcctgacacagtacctg
gacgcgcagggccgcccgcgcaccagccagtcggaggagacgcgcgtctggcaccgccgc
gacggcaagtggcagaacgtccacttccacggctcgggggcccccgtcgctcccctccag
tga

KEGG   Gallus gallus (chicken): 374175
Entry
374175            CDS       T01006                                 

Gene name
CAMK2A
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit alpha
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04012  ErbB signaling pathway
gga04020  Calcium signaling pathway
gga04114  Oocyte meiosis
gga04217  Necroptosis
gga04261  Adrenergic signaling in cardiomyocytes
gga04310  Wnt signaling pathway
gga04912  GnRH signaling pathway
gga04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    374175 (CAMK2A)
   04310 Wnt signaling pathway
    374175 (CAMK2A)
   04020 Calcium signaling pathway
    374175 (CAMK2A)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    374175 (CAMK2A)
   04217 Necroptosis
    374175 (CAMK2A)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    374175 (CAMK2A)
   04916 Melanogenesis
    374175 (CAMK2A)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    374175 (CAMK2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    374175 (CAMK2A)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     374175 (CAMK2A)
Protein kinases [BR:gga01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   374175 (CAMK2A)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 SnoaL_2 Kdo TCAD9
Other DBs
NCBI-GeneID: 374175
NCBI-ProteinID: NP_989626
CGNC: 49072
Ensembl: ENSGALG00000005621
UniProt: O93559
Position
13
AA seq 489 aa
MATITCNRFTEEYQLFEELGKGAFSIVRRCVKVLAGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHHNGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGDQQAWFGFAGTPGYL
SPEVLRKDPYGKAVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPEAKDLINKMLTINPSKRITAAEALKHPWISHRATVASCMHRQETVDCLKKFNARRKLK
GAILTTMLATRNFSGGKSGGNKKNDGVKKRKSSSSVQLMESSESTNTTIEDEDTKVRKQE
IIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKP
VHTTILNPHIHLMGDESACIAYIRITQYVDVGGIPRTAQSEETRIWHRRDGKWQIVHFHR
SGAPSVLPQ
NT seq 1470 nt   +upstreamnt  +downstreamnt
atggccaccatcacctgcaaccgcttcaccgaggagtaccagctctttgaggaactgggc
aagggtgctttctccatcgtccggagatgtgtgaaggtgttggcaggacaagagtatgcg
gccaaaatcatcaacaccaagaagctgtctgcccgagaccaccagaagctggagcgagag
gctcggatctgccgcctcctgaagcaccccaacatcgtgaggctccatgacagcatctct
gaagagggccaccactacctgatattcgacctggtcactggtggggagctgtttgaggac
atcgtggccagagagtactacagcgaagcagatgccagccattgcatccagcagatcctg
gaagctgtcctgcactgccaccacaatggggttgtccaccgggacctgaagcctgagaac
ctgctgctggcctccaagctgaagggggctgctgtcaagctggctgacttcggcctcgcc
attgaggtggagggagaccagcaagcctggttcggttttgctggcaccccggggtacctc
tcccctgaggtcctccgcaaggatccctatggcaaagctgtggacctgtgggcttgtggc
gtcatcctctacatcctgctggttgggtacccaccattctgggatgaagaccagcaccgc
ctctaccagcagatcaaggctggggcttacgacttcccctcccccgagtgggacaccgtc
actcccgaagcgaaagatctcatcaacaagatgctgaccatcaacccgtccaaacgcatc
acggcagcagaggctctgaagcacccctggatatcgcaccgtgccaccgtggcctcgtgc
atgcataggcaggagacggtggattgcctgaagaagttcaacgcccggaggaagctaaag
ggagccatcctcaccaccatgctggccaccaggaacttctccggaggcaaaagtggtggc
aacaagaagaatgacggcgtgaagaaaagaaagtccagttccagcgttcagttaatggaa
tcgtcggagagcaccaacaccaccatcgaggatgaagacaccaaagtacggaagcaagag
atcattaaggtgacagagcagctgatcgaagcaataagcaacggcgacttcgagtcctac
acgaagatgtgtgaccccgggatgactgcttttgagcctgaggctctggggaacctcgtg
gaaggcctggatttccaccgattctactttgaaaacctgtggtcccggaacagcaagcct
gtgcacacgacgatcctgaacccccatattcatctgatgggagacgagtccgcctgcatc
gcctacatccgcatcacgcagtacgtggacgtggggggcatcccccgcactgcccagtct
gaagagacccgcatctggcaccgccgggatggcaaatggcagattgtccacttccacaga
tctggcgcgccctctgtcctaccgcagtaa

KEGG   Gallus gallus (chicken): 422688
Entry
422688            CDS       T01006                                 

Gene name
CAMK2D
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II delta chain
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04012  ErbB signaling pathway
gga04020  Calcium signaling pathway
gga04114  Oocyte meiosis
gga04217  Necroptosis
gga04261  Adrenergic signaling in cardiomyocytes
gga04310  Wnt signaling pathway
gga04912  GnRH signaling pathway
gga04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    422688 (CAMK2D)
   04310 Wnt signaling pathway
    422688 (CAMK2D)
   04020 Calcium signaling pathway
    422688 (CAMK2D)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    422688 (CAMK2D)
   04217 Necroptosis
    422688 (CAMK2D)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    422688 (CAMK2D)
   04916 Melanogenesis
    422688 (CAMK2D)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    422688 (CAMK2D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    422688 (CAMK2D)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     422688 (CAMK2D)
Protein kinases [BR:gga01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   422688 (CAMK2D)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 APH Pkinase_fungal Kdo SnoaL_2 SnoaL_4 DUF4915
Other DBs
NCBI-GeneID: 422688
NCBI-ProteinID: NP_001034389
CGNC: 9123
Ensembl: ENSGALG00000041635
UniProt: Q5ZKI0
Position
4
AA seq 479 aa
MASTATCTRFTDEYQLFEELGKGAFSVVRRCMKITTGQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDT
VTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKL
KGAILTTMLATRNFSAAKSLLKKPDGVKESTESSNTTIEDEDVKARKQEIIKVTEQLIEA
INNGDFEAYTKICDPGLTSFEPEALGNLVEGMDFHRFYFENALSKSNKPIHTIILNPHVH
LVGDDAACIAYIRLTQYMDGTGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPINA
NT seq 1440 nt   +upstreamnt  +downstreamnt
atggcctcaaccgccacctgcaccaggttcaccgacgagtaccagctcttcgaggagctc
gggaaaggggcgttctcggtcgtgaggagatgtatgaaaatcaccacaggacaggagtat
gctgccaaaatcatcaacaccaaaaagctctcagccagggatcaccagaaactggaaaga
gaagctagaatctgtcgtctcttgaagcatcctaatattgtgcggcttcatgacagcata
tcagaagaaggattccattacttagtctttgacttagtcactggaggtgaattgtttgaa
gatatagttgcaagagagtattacagtgaagcagatgccagtcattgtatacagcagatt
ctagaaagtgttaatcattgtcatctaaatggcatagttcacagagacctgaagcctgag
aacttacttttagctagcaaatccaagggagcagcagtaaaactggcagactttggattg
gctatagaagtccaaggggaacaacaggcttggtttggctttgctggcactccaggatac
ctttctccagaagttttacggaaagatccatatggaaaacctgtggatatgtgggcatgc
ggtgtcattctgtatatcctcctggtgggttatcctcctttctgggatgaagaccagcac
agactttaccagcagataaaggctggtgcttatgattttccctcaccagaatgggataca
gtgacccctgaagcaaaagaccttattaataaaatgcttaccatcaaccctgcaaaacgt
atcacagcttcagaagcactaaagcatccatggatctgtcaacgttccactgttgcctct
atgatgcacagacaggagacggtagattgcttgaagaaattcaacgcaagaagaaaacta
aagggggccattttgacaactatgctggctaccagaaatttctcagcagccaagagttta
ctgaaaaagccagatggagttaaggagtccacagagagttccaatacaaccattgaagat
gaagatgtgaaagctcgtaagcaggagattatcaaggttactgagcagttgattgaagct
atcaacaacggggactttgaagcttacacgaaaatctgtgatccaggccttacatccttt
gaacctgaagctttgggtaatctagtagaagggatggacttccatcggttttactttgaa
aatgctttatccaaaagtaataagccaatccacaccattatcctcaatcctcacgtccac
cttgtgggtgatgatgctgcttgcattgcatatatacggctcacgcagtacatggatgga
actgggatgccaaagacaatgcagtcagaggaaacgcgggtctggcaccgtcgtgacggg
aagtggcagaatgttcactttcaccgttcagggtcaccaacagtacctatcaatgcctag

KEGG   Gallus gallus (chicken): 423737
Entry
423737            CDS       T01006                                 

Gene name
CAMK2G
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit gamma isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04012  ErbB signaling pathway
gga04020  Calcium signaling pathway
gga04114  Oocyte meiosis
gga04217  Necroptosis
gga04261  Adrenergic signaling in cardiomyocytes
gga04310  Wnt signaling pathway
gga04912  GnRH signaling pathway
gga04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    423737 (CAMK2G)
   04310 Wnt signaling pathway
    423737 (CAMK2G)
   04020 Calcium signaling pathway
    423737 (CAMK2G)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    423737 (CAMK2G)
   04217 Necroptosis
    423737 (CAMK2G)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    423737 (CAMK2G)
   04916 Melanogenesis
    423737 (CAMK2G)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    423737 (CAMK2G)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    423737 (CAMK2G)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     423737 (CAMK2G)
Protein kinases [BR:gga01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   423737 (CAMK2G)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr SnoaL_3 DUF4440 APH SnoaL_2 Kdo ABC1 RIO1
Other DBs
NCBI-GeneID: 423737
NCBI-ProteinID: XP_015143790
CGNC: 3786
Ensembl: ENSGALG00000005088
Position
6
AA seq 608 aa
MATTATCTRFTDEYQLYEELGKGAFSVVRRCVKKSSSQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQI
LESVNHIHQHDIVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITADQALKHPWVCQRSTVASMMHRQETVECLRKFNARRKL
KGAILTTMLVSRNFSAAKSLLNKKSDGVKKRKSSSSVHLMPQSNNKTSIVSTAKETPPVQ
TSMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKAPPLSTGDGSSVLEGRRHSESKTQTE
SMQSQLSLCFSATTQSCEEKLLAWDSPGQTLELERARSEPLLTPVVPFVLNSAPLRKQEI
IKITEQLIEAINNGDFDAYTKICDPGLTSFEPEALGNLVEGMDFHKFYFENLLSKNSKPI
HTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTTQSEETRVWHRRDGKWLNVHYHCS
GAPAAPLQ
NT seq 1827 nt   +upstreamnt  +downstreamnt
atggccaccacggcaacgtgcacccgcttcaccgacgagtaccagctctacgaggagctt
ggcaagggagccttctccgtggtccgcagatgtgtcaagaaaagttcatcacaggaatat
gctgcaaaaatcatcaacaccaaaaagttgtcagccagagatcaccagaaactggaacgt
gaagctcgaatctgccgacttctaaagcatccgaatattgtgcggcttcatgacagtatt
tcagaagaaggcttccattacctcgtctttgatctggttactggtggggagctatttgaa
gatattgttgccagagagtactacagtgaagcagatgccagccactgtattcatcagata
ctggagagtgtgaatcacattcaccagcatgatatcgtgcacagggatttgaagcctgag
aatttgctactggcaagtaaatgtaaaggtgctgctgtcaaactggctgacttcggactg
gctattgaagtgcagggagagcagcaggcctggtttgggtttgctggcactccaggctac
ctctcccctgaagtcttaagaaaagatccttatggaaaaccagtcgatatatgggcttgt
ggagtgattctgtacatattactagtggggtaccctcccttttgggatgaagatcagcac
aaactctatcagcagatcaaagccggagcctatgacttcccatcacctgagtgggacact
gtgactcctgaagcaaagaatttgatcaaccagatgctgacaataaacccagcaaagcgc
atcacagctgaccaggctctcaaacatccatgggtctgccaacgatctactgttgcttca
atgatgcacaggcaggagactgtggaatgcttgagaaagttcaatgctagaaggaagctg
aagggtgcaatcctcacaacgatgcttgtgtctcggaatttttcagctgccaaaagcctg
ctgaacaagaaatcagatggagtgaagaaaaggaagtcgagctccagtgtgcatttgatg
ccacagagcaacaacaaaaccagtatagtaagcactgcaaaagaaacacccccagtgcag
acgtccatggagcctcaaacaactgttgtccataatgctacagatggcataaagggttct
acagagagctgtaacaccacaaccgaagatgaggatctgaaagctccccctctctccacc
ggggacggcagctcagtgcttgaaggacggaggcacagtgagagcaaaacacagactgag
tccatgcagtcccagctttctctctgtttctcagccactacacagtcttgtgaagagaag
cttcttgcctgggacagcccagggcagacattggagttagagcgtgctcggtcggagccc
ttgctaactccagtagttccctttgtacttaacagtgcaccgttgcgtaaacaagaaatt
attaagataacagagcagctgatagaagccatcaacaatggagactttgatgcttataca
aaaatctgtgatcctggtttgacctcatttgaacctgaagcactggggaacctggttgaa
ggaatggatttccataagttttactttgagaatttactgtcgaagaacagcaagccgata
cacaccaccatcctgaacccccacgtccatgtcatcggtgaagatgctgcttgcatcgca
tatatccgcctgactcagtacattgacggccaaggccggccccgcaccacgcagtccgaa
gagacgcgcgtctggcaccgccgagatggcaagtggctgaatgtccactaccactgctct
ggagcccctgcagcacctctccagtga

DBGET integrated database retrieval system