KEGG   Gallus gallus (chicken): 374244
Entry
374244            CDS       T01006                                 

Gene name
ATP2B1
Definition
(RefSeq) plasma membrane calcium-transporting ATPase 1
  KO
K05850  P-type Ca2+ transporter type 2B [EC:7.2.2.10]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04020  Calcium signaling pathway
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    374244 (ATP2B1)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    374244 (ATP2B1)
Enzymes [BR:gga01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     374244 (ATP2B1)
SSDB
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase ATP_Ca_trans_C Cation_ATPase Cation_ATPase_N Hydrolase Hydrolase_3
Other DBs
NCBI-GeneID: 374244
NCBI-ProteinID: NP_001161474
CGNC: 49100
Ensembl: ENSGALG00000030550
UniProt: Q98SH2
Position
1
AA seq 1205 aa
MGDMANNSVAYSGVKNAVKEANHGEFGVTLAELRSLMELRATDALHKIQECYGDVQGICT
KLKTSPNEGLSGNPADIERREAVFGKNFIPPKKPKTFLQLVWEALQDVTLIILEIAAVVS
LGLSFYQPPGGNEALCGSVNVGEEEEESEAGWIEGAAILLSVVCVVLVTAFNDWSKEKQF
RGLQSRIEQEQKFTVIRGGQVIQIPVADIIVGDIAQVKYGDLLPADGILIQGNDLKIDES
SLTGESDHVKKSLDRDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGDEEEKE
KEKKDKKTKAQDGAAMEMQPLKSEDGVDGDEKDKKRSNLPKKEKSVLQGKLTKLAVQIGK
AGLLMSAITVIILVLYFVIDTSWVQKRPWLAECTPIYIQYFVKFFIIGVTVLVVAVPEGL
PLAVTISLAYSVKKMMRDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAYISEK
HYKKIPAPEAIPENIMAYLVTGISVNCAYTSKILPPEKEGGLPRHVGNKTECALLGFLLD
LKRDYQDVRNEIPEEKLHKVYTFNSVRKSMSTVLKNSDGSFRIFSKGASEIVLKKCFKIL
SADGEPKVFRPRDRDDIVKTVIEPMASEGLRTICLAFRDFPAGEPEPEWDNENDIVTGLT
CIAVVGIEDPVRPEVPDAIKKCQRAGITVRMVTGDNINTARAIALKCGILNPGEDFLCLE
GKDFNRRIRNEKGEIEQERIDKIWPKLRVLARSSPTDKHTLVKGIIDSTIFDQRQVVAVT
GDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKF
LQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTLASLALATEPPTEALLLRK
PYGRNKPLISRTMMKNILGHAFYQLVVVFTLLFAGEKIFDIDSGRNAPLHAPPSEHYTIV
FNTFVMMQLFNEINARKIHGERNVFEGIFNNAIFCTIVLGTFVVQIIIVQFGGKPFSCSK
LSIEQWLWSVFLGMGTLLWGQLISTIPTSRLKFLKEAGHGTQKEEIPEEELAEDVEEIDH
AERELRRGQILWFRGLNRIQTQIRVVNAFRSSLYEGLEKPETRSSIHNFMTHPEFRIEDS
EPHIPLIDDTDAEDDAPTKRNSTPPPSPNKNNNAVDSGIHLTTDMNKSATSSSPGSPLHS
LETSL
NT seq 3618 nt   +upstreamnt  +downstreamnt
atgggtgatatggcaaacaactcggttgcatatagtggtgtaaaaaatgctgtcaaagaa
gctaatcatggagaatttggagtcactcttgcagagctccgttctcttatggaacttcga
gctacagatgcactgcataaaatacaggaatgctatggagatgtgcagggcatctgtaca
aaattgaaaacttcaccaaatgaaggtttaagtggaaatccagcagatatagaaaggaga
gaagcagtttttgggaagaactttatacctcctaaaaagccaaaaacatttcttcagtta
gtatgggaagcactacaggatgttacactaattatattagaaattgcagccgtagtgtcc
ttgggcctttctttttaccagcctcctggaggaaatgaagcattatgtggatcagtaaat
gttggtgaagaggaggaggaatctgaagcaggttggattgaaggagcagcaatcctcctt
tctgtagtttgtgtggtattagtaacagctttcaatgactggagtaaagagaaacaattt
cgaggactgcagagccgtattgaacaagaacagaaattcacagtcatcagaggtggccaa
gtcatccaaataccagtagctgacataattgttggagatattgcacaagtgaaatatggt
gaccttttaccagctgatggcatacttattcaaggaaatgacctcaaaattgatgaaagc
tcactaactggagagtctgaccatgttaagaagtctttggacagagatcctatgctgctt
tcaggtactcatgtgatggaaggctctggaaggatggtagttactgctgtaggtgtgaac
tctcagactggaatcatctttaccttgcttggggctggaggagatgaagaggagaaggaa
aaagagaagaaggacaagaaaactaaagctcaagatggtgcagctatggaaatgcagcca
ctgaagagtgaggatggtgtggatggagatgaaaaagacaagaagagatcaaatttgcca
aagaaagaaaaatctgttctccaaggcaaacttacaaagcttgcagttcagattggcaaa
gcaggtttgttgatgtctgcaatcacagtcattatccttgtgttgtattttgtaatcgat
acctcctgggttcagaagcgaccctggcttgctgaatgtacaccaatttatattcagtac
tttgtgaagttcttcattattggagttacagtcttggtggtggcagtaccagaaggtctt
ccgcttgcagtcaccatatcattggcttattctgttaagaaaatgatgagagacaataac
ttggtgagacatctggatgcatgtgaaacaatgggtaatgcaacagctatttgctcagat
aaaacgggaacattgactatgaacaggatgacagtggtccaagcttacatcagtgaaaag
cattacaaaaaaattccagcaccagaagctattccagagaatatcatggcttaccttgtc
acaggaatttctgttaattgtgcttatacttccaaaatactgcctcctgagaaagaaggt
ggtctaccacgtcatgttggaaacaaaactgaatgtgccttgctgggttttcttttggat
ttaaaacgtgattatcaggatgtacggaatgagataccagaagagaagttgcacaaagtg
tacaccttcaactctgtcagaaaatctatgagtactgtgttaaaaaactctgatggcagt
ttccgaatattcagtaaaggtgcctctgagatagttcttaaaaagtgcttcaaaatactg
agtgctgatggagaaccaaaggtattcagacctagggaccgtgacgatattgtaaaaact
gtaattgagccaatggcttctgaagggcttagaaccatttgtttggcatttagagacttt
ccagcaggggaaccagagccagaatgggacaatgaaaatgacattgttactggtctgacg
tgcattgctgttgttgggattgaagatcctgtgagacctgaggtacccgatgcaataaaa
aaatgtcagcgtgcaggcatcactgtacgtatggtcactggtgataacattaatactgct
cgtgctattgcattaaaatgtggtattctgaatcctggtgaagactttctgtgtttggag
ggcaaagattttaataggagaatacgcaatgaaaaaggagagatagagcaagagcgaata
gataaaatttggccaaagctacgtgttcttgcaagatcatctcctactgacaaacacact
ctagtaaaaggtataattgacagcactatctttgatcagaggcaagttgtagcagtaact
ggtgatggtaccaatgatggtcctgcactgaagaaagcagatgttggatttgctatggga
attgctggaacagatgtagctaaagaagcttctgatattatccttacggatgacaacttc
acgagtattgttaaagcagttatgtggggacgaaacgtatatgacagcatttcaaagttt
cttcagttccagctcacagtcaatgtagtggcagtaattgtcgcttttacaggagcatgc
ataacacaggattctccgcttaaagctgtgcagatgctgtgggtaaatctgataatggac
acattagcttctcttgccttggcgacagaaccacccactgaagctcttctattgcggaag
ccttatggtagaaacaaacctttgatttctcgtacaatgatgaagaatattttgggtcat
gcattctaccaactcgtagtggtctttacactcctgtttgctggtgagaaaatttttgat
attgatagtggaagaaacgcacctctgcatgcccctccttcagagcattatactattgtc
tttaatacatttgtaatgatgcaactttttaatgaaattaatgcccggaaaattcacggt
gaaagaaacgtttttgaaggaatctttaacaacgctatcttctgtactattgttctggga
acatttgttgtgcagataattatcgtgcagtttggtggaaaaccgttcagttgctcaaaa
ctctcaattgaacagtggctgtggtctgttttcctgggcatgggaacactactctggggc
cagttgatttcaacaattccaactagccgcttgaaattccttaaggaagctggtcatggc
acacaaaaggaagagattcctgaagaagagctagcagaagatgtggaggagattgatcac
gctgagcgagaattacgtcgtggtcagatcttgtggtttaggggcctaaacagaatacaa
actcagatacgagtggtgaatgcatttcgtagttctttgtatgaggggctagagaaacct
gagacacgaagttcaattcacaattttatgacgcatcctgagtttagaatagaagactcc
gagcctcatattccccttattgacgatactgatgctgaagatgacgctccaacaaaacgc
aactctactcccccaccctctcccaataaaaataacaatgcggttgacagtggaattcac
cttacaacagacatgaacaagtctgctacctcttcatccccagggagcccgctacatagt
ttggaaacatcactctga

KEGG   Gallus gallus (chicken): 415958
Entry
415958            CDS       T01006                                 

Gene name
ATP2B2
Definition
(RefSeq) plasma membrane calcium-transporting ATPase 2
  KO
K05850  P-type Ca2+ transporter type 2B [EC:7.2.2.10]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04020  Calcium signaling pathway
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    415958 (ATP2B2)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    415958 (ATP2B2)
Enzymes [BR:gga01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     415958 (ATP2B2)
SSDB
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase ATP_Ca_trans_C Cation_ATPase Cation_ATPase_N Hydrolase Hydrolase_3 GET2
Other DBs
NCBI-GeneID: 415958
NCBI-ProteinID: XP_025010530
CGNC: 3584
Ensembl: ENSGALG00000030908
Position
12
AA seq 1285 aa
MGDMTNSDFYSKNQRNEANHAGEFGCTLQELRSLMELRGTEAVVKIKETYGETEGLCRHL
KTSPTEGLAGTAADLEKRKLIFGKNFIPPKKPKTFIQLVWEALQDVTLIILEIAAIISLG
LSFYQPPGEGNEGCGTATGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFR
GLQSRIEQEQKFTVVRGGQVIQIPVAEIVVGDIAQVKYGDLLPADGIFIQGNDLKIDESS
LTGESDQVRKSVDKDPMLLSGTHVMEGSGRMLVTAVGVNSQTGIIFTLLGAGGEEEEKKD
KKGVKQEDGPQLPDSSHPSSHPPSATDGAAGANATDNANASLVNGKMQDGNMENSQNKAK
QQDGAAAMEMQPLKSAEGGEGDDKDKKKSNMHKKEKSVLQGKLTKLAVQIGKAGLVMSAI
TVIILVLYFAIDTFVVKKKQWLPECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISL
AYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAYIGDVHYKEIPDP
DSVPAKTLELLVNAIAINSAYTTKILPPEKEGGLPRQVGNKTECGLLGFVLDLKQDYEPV
RNLIPEEKLYKVYTFNSVRKSMSTVIKMPDGSFRMYSKGASEIVLKKCSRILNAAGEPRI
FRPRDRDEMVKKVIEPMACDGLRTICVAFRDFNSSPEPDWDNENDILSDLTCICVVGIED
PVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAIKCGIIHPGEDFLCLEGKEFNRRIR
NEKGEIEQERIDKIWPKLRVLARSSPTDKHTLVKGIIDSTQVEQRQVVAVTGDGTNDGPA
LKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNI
VAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTEALLLRKPYGRNKPLI
SRTMMKNILGHAVYQLTLIFTLLFVGEKMFKIDSGRNAPLHSPPSEHYTIIFNTFVMMQL
FNEINARKIHGERNVFDGIFRNPIFCTIVLGTFAIQIVIVQFGGKPFSCSPLQLDQWMWC
VFIGLGELVWGQVIATIPTSRLKFLKEAGRLTEKEEVPEEELNEDVEEIDHAERELRRGQ
ILWFRGLNRIQTQIEVVNTFKSGTSFQGALRRQSSVTSQTQDIRVVKAFRSSLYEGLEKP
ESRTSIHNFMTHPEFRIEDSQPHIPLIDDTDLEEDPALKKNSSPPSSLNKNNSAIDSGIN
LTTDTSKSATSSSPGSPIHSLETSL
NT seq 3858 nt   +upstreamnt  +downstreamnt
atgggtgacatgacaaatagtgatttttattccaagaaccaaagaaatgaggccaaccat
gcaggagaatttgggtgcaccctgcaagaactgcgctccctcatggaactccgaggaaca
gaagcagtggtaaaaattaaagagacatatggggaaacagaggggctctgcaggcatctg
aagacatcaccaacagaagggttagctggcactgctgcagatctagaaaaacgaaagctt
atttttggaaaaaacttcatacccccaaagaagccaaaaacgttcatacagctagtgtgg
gaagcactgcaggatgtgactcttataatcttggaaattgcagccatcatatccttgggg
ctttcgttttatcagccacctggagaagggaatgaagggtgtggcactgcaacaggagga
gctgaagatgaaggtgaggctgaagctggctggattgaaggtgctgccatcctgctgtct
gttatctgtgttgtacttgtcactgccttcaatgactggagcaaggagaagcagtttcgt
gggcttcaaagtcgtattgagcaggaacagaaatttactgttgtccgaggtggacaggtt
atccaaatcccagtggcagagatagtagttggtgacattgcacaggtgaaatatggtgat
ctcctacctgccgatgggatatttattcaaggaaatgatcttaaaattgatgaaagttct
ttgactggagaatcagaccaagtccgcaaatctgttgacaaagatccaatgctactgtca
ggtactcacgtcatggaaggctctggacgaatgcttgtaactgctgtgggtgtgaattct
cagacaggcatcatctttactctgttaggtgctggaggagaagaagaagaaaagaaagac
aaaaaaggtgtgaaacaggaggatggacctcagcttccagattcttcccatccctcctcc
caccctccttcagcaacagatggtgcagcaggtgcaaatgccactgataatgcaaatgcc
agcttagtcaatggcaaaatgcaggatgggaatatggagaacagccagaacaaagccaag
cagcaggatggggctgctgccatggagatgcagccactgaagagtgccgaggggggtgaa
ggagatgacaaagacaagaagaaatccaacatgcacaagaaagaaaagtctgtccttcag
ggaaagctgaccaagctggcagtccagataggcaaagcaggtttggtgatgtctgccatc
actgtaatcattttggtactatattttgccattgacacctttgtggtgaaaaagaaacag
tggttacctgagtgcactcctgtctatgttcagtattttgttaaattcttcattattggt
gttactgtacttgtggttgctgtccctgagggtcttccacttgctgtcactatttctttg
gcttattctgtaaagaaaatgatgaaagataacaatctggtccgccacttagatgcctgt
gaaactatgggtaatgccacagccatatgctctgacaaaacagggacgctaacaaccaac
cggatgacagtcgtccaagcctatattggtgatgtgcactacaaagagatccctgaccct
gattctgtacctgctaagaccctcgaattgctggttaatgcaattgctatcaacagtgct
tacactacaaaaattctgccaccagaaaaagagggcggcctgcctcggcaggtgggcaat
aagacggaatgcggcctcctgggctttgtcctggatttgaagcaggattatgagcctgtt
cggaacctcatccccgaggagaaactttataaagtgtacacgttcaactctgtgagaaag
tcaatgagtactgtcattaaaatgccagatggtagtttccgaatgtacagcaaaggagct
tcggaaatcgttctgaagaaatgttccaggatccttaatgcagctggtgaacctcgtatc
ttcaggccacgtgaccgggatgaaatggtcaagaaagtgattgaaccaatggcctgtgat
ggactgagaactatctgtgttgccttccgagacttcaacagcagcccagaacctgactgg
gacaatgaaaatgacattttatctgatctgacttgcatttgtgttgttggcattgaagat
ccagtaagaccagaggtcccagaagccataagaaagtgccagcgagctggaattacagtc
cgcatggtcactggagacaatatcaacacagcacgtgccattgccataaaatgtggaatc
attcatccaggagaagactttctttgccttgaagggaaggagtttaacagaaggatccga
aatgagaagggagagattgagcaagagcggattgacaaaatctggccaaagcttcgagta
cttgctcggtcatctcccaccgacaaacatactttggtcaaaggtattattgacagcaca
caggtggagcagaggcaggttgtagctgtgactggtgatggaaccaatgatggaccagca
cttaagaaagctgatgttggctttgcaatgggtattgctggaacagatgttgcaaaggag
gcctcagatatcatcctaacagatgacaatttcagtagcattgtgaaggctgtaatgtgg
ggacgtaatgtgtatgatagtatctccaaattcctgcagttccagctcactgttaacatt
gtggctgtgatagtggctttcactggagcatgcattacccaggactctcctctaaaagct
gtacagatgctgtgggtcaatctaattatggacacttttgcctcacttgctctggccact
gaacctccaacagaagctctattgctaagaaagccatatggcaggaacaaacctcttata
tcccgtaccatgatgaagaacattctgggccatgctgtctaccagcttactctaatattt
acacttctttttgttggtgagaaaatgtttaagattgacagtgggaggaatgcaccgctc
cactctcctccttcagagcactacaccattatcttcaacacttttgtcatgatgcagctt
ttcaatgaaatcaacgcacgcaaaatccatggagagagaaatgtttttgatggcatcttc
agaaatcctattttttgcactattgtactgggtacatttgctattcagatagtaattgtc
cagtttggaggaaaaccatttagctgttctcccctgcagcttgaccagtggatgtggtgt
gtatttattggattaggagaacttgtatggggtcaggtcattgcaaccatcccaacaagt
aggctaaagtttttaaaggaggcagggcggctcactgagaaggaagaggttcctgaagaa
gaactcaatgaagatgttgaagaaattgatcatgcagagagagaacttcgacgtggacaa
attctctggttcagagggcttaacagaatccaaacccagatcgaagtagtcaatactttc
aagagtggcacttcctttcagggggctctaaggagacagtcctccgtcacaagccagacc
caggatatccgcgtcgtgaaggcattccgtagctctctctatgaaggtttagaaaaacca
gaatctagaacctctattcacaactttatgactcatcctgagtttaggatagaagattcc
cagccccacatcccactcattgatgacacagacctagaagaagaccctgctctcaagaaa
aactcaagtccaccgtcttcgctcaacaagaacaacagtgctatcgacagtggaataaat
cttacaactgacacaagtaaatcagctacctcttctagtccaggaagcccaatacatagc
ctggagacatcactttag

KEGG   Gallus gallus (chicken): 419934
Entry
419934            CDS       T01006                                 

Gene name
ATP2B4
Definition
(RefSeq) plasma membrane calcium-transporting ATPase 4 isoform X2
  KO
K05850  P-type Ca2+ transporter type 2B [EC:7.2.2.10]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04020  Calcium signaling pathway
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    419934 (ATP2B4)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    419934 (ATP2B4)
Enzymes [BR:gga01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     419934 (ATP2B4)
SSDB
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase ATP_Ca_trans_C Cation_ATPase Cation_ATPase_N Hydrolase Hydrolase_3
Other DBs
NCBI-GeneID: 419934
NCBI-ProteinID: XP_004948504
CGNC: 2630
Ensembl: ENSGALG00000003601
Position
26
AA seq 1196 aa
MTNNVADHHPGNSVAEGNHEGDFGCSMVELRNLMELRSAEAVARISDSYGGVQTVCKRLK
TSPVEGLSGNPTDLEKRRQVFGQNFIPPKKAKTFLQLVWEALQDVTLIILEIAAIISLGL
SFYHPPGGDNELCGQSSGGVEDEGEAQAGWIEGAAILFSVIIVVLVTAFNDWSKEKQFRG
LQSRIEQEQKFTVIRKGQVIQIPVAEIVVGDIAQIKYGDLLPADGILIQGNDLKIDESSL
TGESDQVKKSLDKDPMLLSGTHVMEGSGRMVVTAVGINSQTGIIFTLLGAGEGDEEKKVK
KAKTQDGVALEIQPLKSQEGVENEEKEKKKVKVPKKEKSVLQGKLTRLAVQIGKAGLIMS
AITVIILVLYFVIDTFGVQRRPWLAECTPIYIQYFVKFFIIGVTVLVVAVPEGLPLAVTI
SLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQAYVGDTHYRQIP
DPEAILPKVLDLIVNGVAINSAYTSKILPPEKEGGLPRQVGNKTECALLGFVLDLKQDYQ
AVRNEVPEEKLYKVYTFNSVRKSMSTVLKNSDNSFRMYSKGASEIILRKCTKILDKNGDP
RMFKVKDRDEMVKKVIEPMACHGLRTICLAFRDFPADAEPDWDSENEILSDLTCIAVVGI
EDPVRPEVPDAILKCQRAGITVRMVTGDNINTARAIATKCGILLPGEDFLCLEGKEFNRL
IRNEKGEVEQEQLDKIWPKLRVLARSSPTDKHTLVKGIIDSTVGDQRQVVAVTGDGTNDG
PALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTV
NVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPSESLLLRKPYGRNKP
LISRTMMKNILGHAVYQLTIIFTLLFVGEKLFDIDSGRNAPLHSPPTEHYTIVFNTFVMM
QLFNEINARKIHGERNVFEAIYRNPIFCTVVLGTFAAQIIIVEFGGKPFSCSGLTLSQWF
WCIFIGVGELLWGQLICTVPTSHLKFLKEAGHGITKEEIPEEELPEDVDEIDHAEMELRR
GQILWFRGLNRIQTQIKVVNAFRSSLYEGLEKPESRSSIHNFMTHPEFILEEDEPRTPFL
DSAEDDPKTDGLKKRGGGSLGGSSSLNRNNNAVDSDQTEVNFAEPESLFHSLETSV
NT seq 3591 nt   +upstreamnt  +downstreamnt
atgacgaacaacgtggccgaccaccaccccgggaactcggttgctgaaggcaaccatgag
ggggactttggttgctccatggtggagctcaggaatctcatggagctgcggagtgctgag
gcggtcgcccggatcagcgactcctatggcggcgtgcagactgtctgcaagaggctgaag
acatcgccggttgaaggtctgtctgggaacccaactgacctggagaagaggaggcaggtg
tttggccagaacttcattcctcccaagaaagccaagacgttcctgcagttagtgtgggag
gcactccaggacgtcaccctgatcatcttggaaatagcagccataatctccctggggctg
tcgttctaccatcctccaggtggcgacaatgaattgtgtgggcagtcgtcgggtggcgtg
gaggatgagggcgaggcgcaggccggctggatcgagggggcagccatcctgttttcagtc
atcatcgtggtgctggtgaccgccttcaatgactggagcaaagagaagcaattccgtggc
ctccagagccgcattgagcaagaacagaagttcacagtgatccgcaaagggcaggtgatc
cagatccctgtggcagagatcgtggtgggagacatcgcgcagatcaagtacggtgacctc
ttgccagcggatggcatcctgatccaagggaacgacctgaaaatagatgagagctcgctg
actggagaatctgaccaagtcaaaaaatcacttgataaagaccccatgctgctgtcaggt
acccatgtgatggagggctccgggcggatggtggtgactgcagtgggaatcaactcccag
acaggaatcatcttcactctgttgggtgcgggagaaggagatgaggaaaagaaggtgaag
aaagctaaaactcaggatggtgtggccttagagatccaacccctgaagagccaggaaggg
gtggaaaatgaggagaaggagaagaagaaggtgaaggtgcccaagaaggagaagtctgtg
ctccaagggaagctgacacgcctggcggtccagattgggaaggcagggctgatcatgtcg
gccatcacagtgatcatcttggtgctgtactttgtcatcgacacctttggggtgcagcgt
cggccctggctggcagagtgcacccctatctacatccagtactttgtcaaattcttcatc
atcggtgtcaccgtgctggtagtggctgtgcctgagggactcccactggcagtcaccatc
tccctagcctactcagtgaagaaaatgatgaaggacaacaaccttgtgaggcacttggat
gcttgtgagaccatgggtaatgccaccgccatctgctcagacaagactggcacactcacc
atgaaccgaatgactgtggtgcaggcttatgtgggggacactcactaccgccagatccct
gaccctgaagccatcctgcccaaggtcctggacctcattgtgaatggtgttgccatcaat
tctgcctacacatccaagatcctgccaccagagaaggaaggggggctaccccggcaagtg
gggaacaagacagaatgtgccttgctgggcttcgtgctggacctgaagcaggattatcag
gccgtgcggaatgaggtgccggaggagaagctctacaaggtctacaccttcaactcggtg
cgcaagtccatgagcacggtgctcaagaacagcgacaacagcttccgcatgtacagcaag
ggagcctctgagatcatcctccgcaagtgcaccaagatcctggacaagaatggtgacccc
cggatgttcaaagtgaaggatcgggatgagatggtgaagaaggtgattgagcccatggca
tgccacgggctgcggaccatctgcctggccttccgtgactttcctgctgacgctgagccc
gactgggacagtgagaatgagatcctgtctgacctgacctgcattgctgtggtgggaata
gaggaccctgtgcggccagaggtgccagatgccatcctgaagtgccagcgtgcaggcatc
actgtccgcatggtgactggggataacatcaacactgcccgtgccattgccaccaagtgt
ggcatcctgctgcctggagaggacttcctgtgcctggaggggaaggagttcaaccggctc
atccgcaacgagaagggcgaggtggaacaggagcagctggacaagatctggcccaagctg
cgcgtgctggcccgctcgtccccaacagataaacacacacttgtcaaaggaattattgac
agcactgttggtgaccagcggcaggtggtggctgtcaccggggatgggaccaatgatggc
cctgctctgaagaaagctgatgttggatttgctatgggcattgcaggcactgatgttgca
aaggaggcttcagacatcatcctgacggatgacaacttcaccagcattgtcaaggcagtg
atgtggggtcgcaacgtctatgacagcatctccaagttcctgcagttccagctgactgtt
aacgtggtggctgtcattgtggctttcacgggcgcctgcatcacgcaggattctcccctg
aaagctgtgcagatgctgtgggtgaacctgatcatggacacctttgcctccttagccctg
gccacggagcccccgtctgagtccctgctgctccgcaagccgtatggccgcaacaagcca
ctcatctcccgcaccatgatgaagaacatcctgggacacgctgtgtaccagctgactatc
attttcacgctgctttttgtgggggagaagctgtttgacattgacagtggccggaatgcc
ccattgcattccccacccaccgagcactacaccatcgtcttcaacacgttcgtcatgatg
caattattcaatgagatcaatgcacgcaagatccatggggagaggaatgtgtttgaggcc
atctaccgcaaccccatcttctgcacagtggtgctggggacgtttgcagcccagatcatc
attgtggagtttggtgggaagccattcagctgctctgggctcaccctgagccagtggttc
tggtgtatatttattggagtgggagagctcctctggggccagctgatctgcacagtcccc
accagccacctgaagttcctgaaggaagctgggcatggcatcaccaaggaggagatccca
gaggaagagctgccagaggatgtggatgagatagaccatgctgagatggagctgcggcgt
gggcagatcttgtggttcaggggtctcaacaggatacaaacacagatcaaggtggtgaat
gcgttccgtagctccttgtacgaaggcctcgagaaacctgagtccagaagctccatccat
aacttcatgactcacccagagttcatcctggaggaagatgagcctcgaacaccattcctt
gacagtgctgaagatgaccccaagaccgacggactcaaaaagcgaggtgggggcagcctg
ggtggatcttcatccctcaacagaaataacaacgcagtggacagtgatcaaaccgaggtc
aactttgcggagcctgaaagcctctttcacagcttggagacatcggtttga

DBGET integrated database retrieval system