KEGG   Gallus gallus (chicken): 395350
Entry
395350            CDS       T01006                                 

Gene name
MYH7
Definition
(RefSeq) myosin-7
  KO
K17751  myosin heavy chain 6/7
Organism
gga  Gallus gallus (chicken)
Pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    395350 (MYH7)
   04261 Adrenergic signaling in cardiomyocytes
    395350 (MYH7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gga04812]
    395350 (MYH7)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     395350 (MYH7)
SSDB
Motif
Pfam: Myosin_head Myosin_tail_1 Myosin_N Filament Crescentin AAA_22 IQ ATP-synt_ab AAA_16
Other DBs
NCBI-GeneID: 395350
NCBI-ProteinID: NP_001001302
CGNC: 49277
Ensembl: ENSGALG00000035594
UniProt: Q910C5
Position
19
AA seq 1931 aa
MEALLGAAAPFLRAPEGPRPTPAGDTRGLCFVPHPQLEFIRARVTARAGNGVTVTTEMGE
TLTVPEADVHPQNPPKFDRIEDMAMLTFLHEPAVLYNLKERYASWMIYTYSGLFCVTVNP
YKWLPVYNAEVVAAYRGKKRTEVPPHIFSISDNAYQNMLTDRENQSILITGESGAGKTVN
TKRVIQYFASIAAIGHRKKEVANSSKGTLEDQIIQANPALEAFGNAKTVRNDNSSRFGKF
IRIHFGATGKLASADIETYLLEKSRVIFQLKAERNYHIFYQILSNKKPELLEMLLITNNP
YDYSYVSQGEVTVASIDDSEELLATDSAFDVLGFTAEEKAGVYKLTGAIMHFGNMKFKQK
QREEQAEPDGTEDCDKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQSVQQVYYSIGAL
AKAVYEKMFNWMVVRINNSLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINFTNEKLQQ
FFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKASDMT
FKAKLFDNHLGKSANFGKPRNVKGKSEAHFSLIHYAGTVDYNIIGWLEKNKDPLNETVVG
LYQKSALKLLASLFSNYAGADAGGDGGKGKGAKKKGSSFQTVSALHRENLNKLMANLKTT
HPHFVRCLIPNERKEPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQRYRIP
NPTAIPEGQFIDSRKGAEKLLGSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDERLSLII
TRIQAQARGQLMRIEFKKILERRDALLVIQWNIRAFMGVKNWPWMKLYFKIKPLLKSAET
EKEMQTMKEEFGHLKEALEKSAARRKELEEKMVSMLQEKNDLQLQVQAEQDNLADAEERC
DQLIKNKIQLEAKVKEMTERLEEEEEMNAELAAKKRKLEDECSELKKDIDDLELSLAKVE
KEKHATENKVKNLTEEMAGLDENITKLTKEKKILQESHQQALDDLQAEEDKVNTLAKAKG
KLEQQVDDLESSLEQEKKIRMDLERAKRKLEGDLKLAQESIMDLENDKQQLEERLKKKDF
ELNTLNARIEDEQAISAQLQKKLKELQARIEELEEELEAERTGRAKVEKLRSELLQELEE
TSERLEEAGGATSVQLELNKKREAEFQKLRRDLEEATLQHEATAATLRKKHADSVAELSE
QLDNLQRVKQKLEKEKSELKLELDDVNSNTEQLIKAKTNLEKMCRTTEDQMNEHRSKLEE
AQRTVTDLSTQRAKLQTENSELSRQLEEKEAFINQLTRGKLTYTQQLEDLKRQLEEEAKA
KNALAHALQSAQHDCDLLREQYEEEMEAKAELQRALSKANSEVAQWRTKYETDAIQRTEE
LEEAKKKLAQRLQEAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMADVERSNAAAAALDKK
QRNFDKILSEWKQKFEESQTELEASQKEARSLSTELFKLKNAYEESLEHLETFKRENKNL
QEEILDLTEQLGASQKSIHELEKVRKQLDAEKLELQAALEEAEASLEHEEGKILRAQLEF
NQVKADYERKLAEKDEEIEQSKRNHLRVVDSLQTSLDAETRSRNEALRLKKKMEGDLNEM
EIQLSHANRTAAEAQKQVKALQGYLKDTQLQLDDVVRANEDLKENIAIVERRNNLLQSEL
EELRAMVEQSERARKLAEQELIEASERVQLLHSQNTSLINQKKKMEADISQLQTEVEEAI
QECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTVKDLQLRLDEAEQLAL
KGGKKQLQKLEVRVRELENELEAEQKRNAESIKGLRKSERRVKELSYQTEEDRKNMVRLQ
DLVDKLQLKVKAYKRQAEEAEEQANSNLAKFRKVQHELDEAEERADMAESQVNKLRARSR
DIGAKKGLNEE
NT seq 5796 nt   +upstreamnt  +downstreamnt
atggaggcattgctgggtgctgctgcccctttcctccgtgcccctgaggggccccgtcca
accccagcaggcgacactcgagggctctgcttcgtgccccacccgcagcttgagttcatc
cgtgcccgtgtcactgcccgggcagggaatggggtcaccgtcaccacagagatgggggag
accttgacagtgcccgaggccgatgtgcacccccagaaccccccaaaatttgaccgcatt
gaggacatggccatgctgacgtttctccatgagcccgccgtcctctacaatctcaaggag
cgctatgcttcctggatgatctatacctactcggggctcttttgtgtcactgtcaaccca
tacaagtggcttccagtctacaatgctgaggtagtggctgcctaccggggcaagaagcgg
actgaggtcccaccccacatcttctccatctcggataatgcataccagaacatgctgacg
gatcgtgagaaccagtccatcctcatcactggagaatccggagcggggaagactgttaat
accaagagggtcatccagtactttgccagcattgccgccattgggcaccgcaaaaaggag
gtggcaaatagcagcaaggggaccctggaggatcaaatcatccaggctaaccctgccttg
gaggcctttggcaatgccaagactgtccgcaatgacaactcttcacgatttgggaagttc
atccggatccactttggggctactgggaagttggcatcagctgatatcgagacctacctc
ctggagaagtcccgagtcatcttccagctgaaggctgagcggaactaccacatcttctac
cagatcctctccaacaagaagcctgagcttctggagatgctgctcatcaccaacaaccct
tatgactacagttacgtctcccaaggagaggtgaccgtggcctccattgatgactcggaa
gagctgttggcaaccgatagtgctttcgatgtcctgggcttcactgctgaggagaaggct
ggtgtctacaagctgacgggtgccatcatgcactttggcaatatgaagttcaagcagaag
caacgggaggagcaggcggagccagacggcactgaagattgcgacaagtcggcttacctg
atggggctaaactcagccgacctcctcaagggtctgtgccatccccgggtgaaggtgggc
aacgagtacgtcaccaaaggacagagcgtccagcaggtctactactccattggggctctg
gccaaggccgtctatgagaaaatgttcaactggatggtggtcaggatcaacaactcgctg
gagaccaaacagcctcgtcaatacttcatcggtgttctggatattgctggctttgagatc
tttgatttcaacagctttgagcagctctgtatcaacttcaccaatgagaagctgcagcag
ttcttcaatcaccacatgtttgtgctggagcaggaagagtacaagaaggagggaattgag
tgggaattcattgattttggcatggacctccaggcctgcattgatctcatcgagaagccc
atggggatcatgtccatcctggaggaggagtgcatgttccccaaagcttcagacatgacc
ttcaaggccaaactgtttgacaaccacttgggcaaatcagccaattttgggaaaccccgg
aatgtcaaagggaagtcagaagcccacttctcactcatccactacgcgggcacagtggat
tacaatatcattggttggttggagaagaacaaggatcccctcaatgagacagtggtgggg
ctctaccagaagtcagccctcaagctattggccagtctcttctccaactatgctggggca
gatgctggtggtgacggtggaaaggggaaaggagccaagaagaaaggttcctccttccag
actgtctcagccctgcaccgggagaacctcaacaagctgatggccaaccttaagacaacc
catccccactttgtccgctgtctcatccctaatgagaggaaggagccgggtgtgatggac
aaccccctggtgatgcaccagctccgctgcaacggggtgctggagggaatccgcatctgc
cgcaagggttttcccaaccgcatcctctatggggacttccgccaacggtaccgcattccg
aaccccacagccatccccgaggggcagttcattgacagtcgcaagggcgctgagaagctc
ctggggtcccttgacattgaccacaaccagtacaaatttgggcacaccaaggtcttcttc
aaggctgggctgctggggctgttggaggagatgcgagatgagcgcctctccctcatcatc
acccgcatccaagctcaagcccggggccagctcatgcgcatagagttcaagaagatcctg
gagcgccgggatgcactcttggtaatccaatggaatatccgtgccttcatgggggtgaag
aactggccctggatgaagctctacttcaagatcaagcccctgctgaagagtgctgagact
gagaaggagatgcagacaatgaaggaggaatttgggcatctgaaggaagccttggagaag
tcagcggcacgtcggaaggagctggaggagaagatggtttccatgctgcaggagaagaat
gacctccagttgcaagtgcaggctgaacaagacaatcttgctgatgctgaggagcgctgt
gatcagctgatcaagaacaagatccagctggaggccaaagtgaaggagatgacagagagg
ctagaggaagaagaggagatgaacgctgagctggcagccaagaagaggaagctggaggac
gaatgttcagagcttaagaaggacattgatgacctggagctgtctttggccaaagtggag
aaggagaaacatgccacagagaacaaggtcaagaacctcacagaggagatggccgggctg
gatgagaacatcaccaagctgaccaaagagaagaagatcctgcaggagtctcaccagcag
gccctggatgacctgcaggctgaggaagacaaggtcaacactttggcgaaggccaaaggt
aagctggaacagcaagtggatgatctggagagctcactggaacaggagaaaaagatacgg
atggacctggaacgagccaaaaggaagctggaaggtgacttaaagctagctcaggagagc
attatggacctggagaatgacaagcagcagctggaggagaggctgaaaaagaaagacttt
gaactcaacacactcaatgctcgaattgaggatgagcaagcgatttctgcccagctccag
aagaagctgaaagagcttcaggcacggattgaggagctggaggaggaactagaggcagag
cggacgggccgggctaaggtggagaagctgcgctcagagctgttgcaggaactggaggag
accagtgagcggctggaggaggcaggtggtgccacttcagtgcagctcgagcttaacaag
aagcgggaagccgaattccagaagctgcggagggacctggaggaggccacattgcagcac
gaggccacggctgccacgctgcgcaagaagcatgctgacagtgtagctgagttgagtgag
cagcttgacaacctgcagcgtgtcaagcagaagctggagaaggagaagagtgagctcaag
ctggagctggatgatgtcaactccaacacggagcagctcatcaaggccaagaccaacctg
gagaagatgtgccgcaccacagaagaccagatgaatgagcaccgcagcaagttggaggag
gctcagcgcactgtcactgacctcagcacccagcgagccaagctccagacagagaacagt
gagctctcaaggcagctggaggagaaggaagctttcatcaaccagctgacgcgagggaaa
ctcacctacactcagcagctggaggacctcaagaggcagctggaggaggaggccaaggcc
aagaatgcattggcccatgccctccaatcagcccagcatgactgtgacctgctgcgggag
cagtacgaggaggagatggaggccaaggctgagctccagcgcgctctctccaaggcgaac
tctgaggtggcccagtggagaaccaagtatgagacagatgccatccaacgcactgaggag
ctggaggaggccaagaagaagctggcacaacggcttcaagaagctgaggaggctgtggag
gcagtcaatgccaagtgctcctccttggagaagaccaagcaccggctgcagaatgagatc
gaggacttgatggcagatgtagagaggtcaaatgcagcagctgctgctctggacaagaag
cagcggaactttgacaagatcttgtcagaatggaaacagaagttcgaggagtcgcaaaca
gagctggaggcatcacagaaggaggctaggtccctcagcactgagctcttcaagctgaag
aatgcctatgaggaatcactggagcacctggagaccttcaagagggagaataagaacctc
caagaggagatcttggacctcacagagcagctcggagccagccaaaaatccatccatgag
ctggagaaggtccggaagcaactggatgcggagaagctggagctgcaagcagcactggag
gaggcagaggcgtctctcgagcatgaggaggggaagatcctgagggcccagctagagttt
aatcaagtgaaggctgactatgagcgcaagcttgctgagaaggatgaggagatagagcaa
tccaagcgtaaccacctgcgggtggtggactcactgcagacctcactggatgctgagaca
cgaagccgaaatgaggccttgaggctgaagaagaagatggagggtgacctcaatgagatg
gagatccagctgagccatgccaaccgtacggcagctgaggcccagaagcaagtcaaggca
ctgcagggctatctcaaggacacccaattacagctggatgatgttgtgagagctaatgag
gacctgaaagagaacattgctattgtggagcggaggaacaacctcctccagtcagagcta
gaggagctgcgggctatggtggagcagagcgagcgggctcgcaaattggctgagcaggaa
ctgattgaggccagtgagcgggtccagcttctccactcccagaacaccagcctcattaac
cagaagaagaagatggaggccgacatctcccagctgcagacagaggtggaagaagccatc
caggagtgccggaatgctgaggagaaagccaagaaggctatcactgatgcggccatgatg
gcagaagagctgaagaaggagcaggacacaagtgcccacctagagcggatgaagaagaac
atggagcagactgtcaaggacctccagctgaggctggatgaggctgagcagctggccctc
aagggaggcaagaagcagctgcagaagttggaagttcgggtgcgggagctggagaatgag
ctggaggctgagcagaagcgcaatgctgagagcatcaagggactccgcaagtcagagcgg
cgtgtcaaggagctcagctaccagacagaggaagaccggaagaacatggtgaggctacag
gacttggtggacaagctgcagctgaaggtgaaggcctataagaggcaggcagaggaggcg
gaagagcaggccaactccaacctggccaagttccgcaaggtgcagcatgagctggatgag
gcggaggaacgtgctgacatggctgagtctcaggttaacaagctgcgggcacggagccgt
gacattggggccaagaaaggactcaatgaggaatga

KEGG   Gallus gallus (chicken): 396067
Entry
396067            CDS       T01006                                 

Gene name
MYL3
Definition
(RefSeq) myosin light chain 1, cardiac muscle
  KO
K12749  myosin light chain 3
Organism
gga  Gallus gallus (chicken)
Pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
gga04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    396067 (MYL3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    396067 (MYL3)
   04261 Adrenergic signaling in cardiomyocytes
    396067 (MYL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gga04812]
    396067 (MYL3)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     396067 (MYL3)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_8 EF-hand_9 DUF2267
Other DBs
NCBI-GeneID: 396067
NCBI-ProteinID: NP_990490
CGNC: 49636
Ensembl: ENSGALG00000005448
UniProt: P02606
Position
2
AA seq 194 aa
MPPKKPEPKKAPEPKKEEPKPAPKPAEPEPKKEVEFNPASIKVEFTPDQIEEFKEAFSLF
DRTPKSEMKITYAQCGDVLRALGQNPTQAEVMKVLGRPKQEEMNSKMIDFETFLPMLQHI
SKTKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLRTLGERLTEEEVDKLMAGQEDANG
CINYEAFVKHIMAN
NT seq 585 nt   +upstreamnt  +downstreamnt
atgcctccaaagaagcctgaacctaagaaggcgcctgaacccaagaaggaagaacccaaa
ccagcacctaagccagcagaaccagagcccaaaaaagaagttgaatttaacccagcttct
atcaaagttgaattcacccccgatcagattgaagaatttaaggaagcgttctcacttttt
gaccgtactcccaaatctgagatgaagatcacatatgcgcaatgtggagatgtcttgagg
gctttggggcagaatccaacccaggctgaggtcatgaaggtgcttggcagacccaaacaa
gaagagatgaactccaagatgattgactttgagaccttcctgcccatgctccagcacatt
tccaagacaaaagacacaggcacctacgaggactttgtggaaggtctgcgtgtgtttgac
aaggagggaaatggaacagtgatgggggctgaacttcgccatgttctgcgtacgctgggt
gaaaggttgactgaagaggaagttgataagctaatggctggccaggaagatgccaatggt
tgtatcaactatgaagcttttgtgaaacatatcatggctaactga

KEGG   Gallus gallus (chicken): 396472
Entry
396472            CDS       T01006                                 

Gene name
MYL4
Definition
(RefSeq) myosin light chain, embryonic
  KO
K12750  myosin light chain 4
Organism
gga  Gallus gallus (chicken)
Pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
gga04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    396472 (MYL4)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    396472 (MYL4)
   04261 Adrenergic signaling in cardiomyocytes
    396472 (MYL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gga04812]
    396472 (MYL4)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     396472 (MYL4)
SSDB
Motif
Pfam: EF-hand_9 EF-hand_1 EF-hand_6 EF-hand_7 Ribosom_S30AE_C
Other DBs
NCBI-GeneID: 396472
NCBI-ProteinID: NP_990810
CGNC: 49822
Ensembl: ENSGALG00000000585
UniProt: P09540
Position
27
AA seq 185 aa
MPLKKPDPKKDAAKAAAAPEVPKEFTFDPKSVKIEFAAEQIEEFKEAFSLFDRTPTGAMQ
ITYAQCGDVLRALGHNPTNAEVLKVLGKPKPEDLNTKMLDFETFLPILQHFTRNREQGTF
EDFVEGLRVFDKEGNGLVMGAELRHVLVTLGEKMTESEVEQLMAGLEDANGCINYEAFVK
HIMSG
NT seq 558 nt   +upstreamnt  +downstreamnt
atgccgctcaagaaacccgaccccaagaaggatgcggccaaagcggccgcagccccggag
gtgcccaaggagttcaccttcgaccccaaaagcgtgaagatcgagttcgctgcggagcag
atcgaagagttcaaggaagccttcagcctgtttgaccggacgcccacgggagccatgcag
atcacctacgcgcagtgcggggacgtcctgcgggcactgggtcacaaccccaccaacgct
gaggtcctgaaggtgctgggcaagcccaaaccagaagacctgaacacgaagatgttggac
tttgagaccttcctccccatcctgcagcacttcacccgcaacagggagcagggcaccttc
gaggacttcgtggaagggctgcgcgtcttcgacaaggagggcaacggcctggtgatggga
gcagagctgcgccacgtgctggtcacgctgggggagaagatgacagaaagcgaggtggag
cagctcatggcaggactagaagacgccaacggctgcatcaactacgaagcttttgtcaag
cacatcatgtctggctga

KEGG   Gallus gallus (chicken): 416874
Entry
416874            CDS       T01006                                 

Gene name
MYL2
Definition
(RefSeq) myosin regulatory light chain 2A, cardiac muscle isoform
  KO
K10351  myosin regulatory light chain 2
Organism
gga  Gallus gallus (chicken)
Pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
gga04371  Apelin signaling pathway
gga04510  Focal adhesion
gga04530  Tight junction
gga04810  Regulation of actin cytoskeleton
gga05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    416874 (MYL2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    416874 (MYL2)
   04530 Tight junction
    416874 (MYL2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    416874 (MYL2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    416874 (MYL2)
   04261 Adrenergic signaling in cardiomyocytes
    416874 (MYL2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    416874 (MYL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gga04812]
    416874 (MYL2)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     416874 (MYL2)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_6 EF-hand_5
Other DBs
NCBI-GeneID: 416874
NCBI-ProteinID: NP_001258858
CGNC: 50364
Ensembl: ENSGALG00000004582
Position
15
AA seq 165 aa
MAPKKAKKRIEGANSNVFSMFEQAQIQEFKEAFTIMDQNRDGFIDKADLRDTFAALGRLN
VKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGLKSAYIKE
MLMTQGERFSQEEIDQMFAAFPPDVSGNLDYKNLVHVITHGEEKD
NT seq 498 nt   +upstreamnt  +downstreamnt
atggcacccaagaaagccaagaagaggattgaaggtgcgaattccaatgtcttctccatg
ttcgagcaggcccagatccaggaattcaaagaggcgttcaccatcatggatcagaaccga
gacggcttcatcgacaaggcagacctgagagatacatttgctgcactcgggcgcctgaat
gtgaaaaacgaggagatcgatgagatgatcaaggaggcacctggcccaatcaacttcact
gtgttcctcaccatgtttggggagaaactcaagggtgctgatccagaggagacgatcctg
aacgcgttcaaggtgtttgatccggagggcaaagggctgaaatctgcctacatcaaagaa
atgctgatgacgcagggcgagaggttttcccaggaggagatcgatcagatgtttgctgcc
ttccctccagacgtctccggcaacctcgactacaaaaacctcgtccacgtcatcacacac
ggagaggagaaggactaa

KEGG   Gallus gallus (chicken): 429272
Entry
429272            CDS       T01006                                 

Gene name
MYO7L2
Definition
(RefSeq) myosin-7
  KO
K17751  myosin heavy chain 6/7
Organism
gga  Gallus gallus (chicken)
Pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    429272 (MYO7L2)
   04261 Adrenergic signaling in cardiomyocytes
    429272 (MYO7L2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gga04812]
    429272 (MYO7L2)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     429272 (MYO7L2)
SSDB
Motif
Pfam: Myosin_head Myosin_tail_1 IQ Crescentin DUF1664 AAA_22 AAA_16 Filament
Other DBs
NCBI-GeneID: 429272
NCBI-ProteinID: XP_025002170
CGNC: 53608
Position
Unknown
AA seq 1689 aa
MVKISLKMAALPYPHPTASSPPPFLPTQTVTVREDQIMQQNPPKFDRIEDMAMLTFLHEP
AVLYNLKERYASWMIYTYSGLFCVTVNPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISD
NAYQNMLTDRENQSILITGESGAGKTVNTKRVIQYFAVIAAIGDRGKKETGTPGKGTLED
QIIQANPALEAFGNAKTVRNDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLK
AERNYHIFYQILSNKKPELLDMMLVTNNPYDYAFISQGETTVPSIDDGEELLATDSAFDV
LGFSPEEKSSIYKLTGAIMHFGNMKFKQKQREEQAEPDGTEEADKSAYLMGLNSADLLKG
LCHPRVKVGNEYVTKGQNVQQVIYAVGALAKAVYEKMFNWMVTRINNSLETKQPRQYFIG
VLDIAGFEIFDFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQ
ACIDLIEKPMGIMSILEEECMFPKATDMTFKAKLFDNHLGKSANFGKPRNIKGKPEAHFA
LVHYAGTVDYNIIGWLQKNKDPLNETVVGLYQKSALKLLANLFANYAGADAPVEKGKGAK
KKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCIIPNETKSPGVMDNPLVMHQLRCNGV
LEGIRICRKGFPNRILYGDFRQRYRILNPAAIPEGQFIDSRKGAEKLLGSLDIDHNQYKF
GHTKVFFKAGLLGLLEEMRDERLARIMTRLQAQVRGFLSRQEFKKILERRDSLLVIQWNI
RAFMGVKNWPWMKLYFKIKPLLKSAETEKEMQTMKEEFGRLKEALEKSEARRKELEEKMV
SMLQEKNDLQLQVQAEQDNLADAEERCDQLIKNKIQLEAKAKEMLERLEEEEEMNAELTA
KKRKLEDECSELKKDIDDLELSLAKVEKEKHATENKVKNLTEEMAGLDETIVKLTKEKKA
LQESHQQTLDDLQAEEDKVNTLTKAKVKLEQQVDDLESSLEQEKKIRMDLERAKRKLEGD
LKLAQESIMDLENDKQQLEERLKKKDFELNALNARIEDEQAVAGQLQKKLKELQARIEEL
EEELEAERTGRAKVEKLRSDLSRELEEISERLEEAGGATSVQLELNKKREAEFQKLRRDL
EEATLQHEATAAALRKKHADSVAELSEQLDNLQRVKQKLEKEKSELKLELDDVSSNMEQL
IKAKANLEKMCRTTEDQMNEHRSKSEEAQRMVADLSTQRAKLQTENGELSRQLEEKEAFI
NQLMRGKLTYTQQLEDLKRQLEEEAKAKNALAHALQSARHDCDLLREQYEEEMEARAELQ
RALSKANLEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQEAEEAVEAVNAKCSSLEKTK
HRLQNEIEDLMADLERSNAAAAALDKKQRNFDKILSEWKQKFEESQTELEAAQKESRSLS
TELFKLKNAYEESLEHLETFKREAKNLQEEISDLTEQLGAGHKTIHELEKVRKQLDAEKL
ELQAALEEAEASLEHEEGKILRAQLEFNQVKADYERKLAEKEEEMEQAKRNHLRVVDSLQ
TSLDAETRSRNEALRLKKKMEGDLNEMEIQLSHANRMAAEAQKQVKALQGYLKVPLGPPR
GGGAVGWAEVGCWVGIQFPVGNGRVGVVGVSLVPDGRPLAAQWAAVGRPFCAQLVIPPWP
LAAQWAAGW
NT seq 5070 nt   +upstreamnt  +downstreamnt
atggtcaaaatcagcctcaaaatggccgcgctgccctaccctcaccccacagcttcctcc
ccccccccttttcttcccacgcagacggtgacggtgagggaggaccaaatcatgcagcag
aaccccccgaaattcgaccgcattgaggacatggccatgctgacgttcctccacgagccc
gccgtcctctacaacctcaaggagcgctacgcctcctggatgatctacacctactcgggc
ctcttctgcgttaccgtcaacccctacaagtggctgccggtatacaacgctgaggtggtg
gccgcctaccggggcaagaagcggagcgaagctcctcctcacatcttctccatctcagat
aacgcctaccagaacatgctgacagatcgggagaaccagtccatcctcatcaccggagaa
tccggggcggggaagaccgtcaacaccaaaagggtcatccaatacttcgccgtcatcgct
gccattggcgaccgcggcaagaaggagacggggacgccggggaaggggaccctggaggat
caaatcatccaagccaaccccgccctggaggccttcggcaacgccaagaccgtccgcaac
gacaactcgtcgcgatttggcaagttcatccggatccacttcggggccaccgggaagttg
gcgtcggctgatatcgagacctacctcctggagaagtcgcgggtcatcttccagctcaaa
gccgagaggaactaccacatcttctaccagatcctctccaacaagaagcccgagcttctg
gacatgatgctggtgaccaacaacccctacgactacgccttcatctcccaaggagagacc
accgtgccgtccatcgacgacggcgaggagctgctggccacagacagcgctttcgacgtg
ctgggcttcagcccggaggagaagagctccatctacaagctgacgggagccatcatgcac
ttcggcaacatgaaattcaagcagaagcagcgggaggagcaggcggagccggacggcacc
gaagaggcggataagtcggcttacctgatggggctgaactcggccgacctcctcaagggg
ctgtgccacccccgggtgaaggtgggcaacgaatacgtcaccaaagggcagaacgtccag
caggtgatctacgccgtcggggctctggccaaggctgtctatgagaagatgttcaactgg
atggtgaccaggatcaacaactcactggagaccaagcagcctcgccagtatttcatcggc
gtcctggacattgctggcttcgagatcttcgatttcaacagcttcgagcagctgtgcatc
aacttcaccaacgagaagctgcagcagttcttcaaccaccacatgttcgtgctggagcag
gaggagtacaagaaggagggcatcgagtgggagttcatcgacttcggcatggacctccag
gcctgcatcgacctcatcgagaagccgatggggatcatgtccatcttggaggaggagtgc
atgttccccaaggccacggatatgaccttcaaggccaaactcttcgacaaccacttgggg
aagtcggccaacttcgggaagccccgcaacatcaagggaaagccggaagctcacttcgcc
ctcgtgcactacgcgggcacggtggactacaacatcatcggctggctgcagaagaacaag
gatccgctcaacgagacggtggtggggctctaccagaagtcagccttgaagctcctcgcc
aacctctttgccaactacgccggagccgacgcgcctgtggagaaggggaaaggagccaag
aagaaaggttcctccttccagacggtctcagccctgcaccgggagaatctcaacaagctg
atgaccaaccttcgttccacccacccccactttgtccgctgcatcatccccaacgagacc
aagtctcccggtgtgatggacaaccccctggtgatgcaccagctccgctgcaatggcgtg
ctggagggcatccgcatctgccgcaagggtttccccaaccgcatcctctacggggacttc
cgtcagaggtaccgcatcctgaacccggcagccatccccgaggggcagttcattgacagc
cgcaaaggcgccgagaaactcctggggtccctcgatatcgaccacaaccagtacaaattt
gggcacaccaaggttttctttaaggccgggctgctggggctgctggaggagatgcgtgac
gagcgcctggctcgcatcatgacccgcctgcaggcccaagttcgtggctttctctcccgg
caggaattcaaaaagatcttggagagaagggattcgctgctggtcatccaatggaacatc
cgcgccttcatgggggtgaagaactggccctggatgaagctctactttaagatcaagccc
ttgctgaagagtgctgagaccgagaaggagatgcagacgatgaaggaggaattcgggcgc
ctgaaggaggccctggagaagtcagaggcgcgtcggaaggagctggaggagaagatggtg
tccatgctgcaggagaagaacgatctccagctgcaagtgcaggccgagcaagacaatctt
gctgacgccgaggagcgctgcgatcagctgatcaagaacaagatccagctggaggccaag
gcgaaggagatgttggagaggctggaggaagaggaggagatgaacgctgagctgacggcc
aagaagaggaagctggaggatgagtgttcggagctcaagaaggacatcgatgacctggag
ctgtcgttggccaaagtggagaaggagaaacacgccacagagaacaaggtcaagaacctc
acagaggagatggccgggctggatgagaccattgtcaagctgaccaaggagaagaaggcc
cttcaggagtcccaccagcaaacgctggatgacctgcaggccgaggaagacaaggtcaac
accttgaccaaggccaaagtgaagctggagcagcaagtggatgatcttgagagctcgctg
gagcaggagaagaagatccggatggacctggaaagagccaagaggaagctggaaggggac
ttgaagctggcccaggagagcatcatggacctggagaacgacaagcagcagctggaggag
aggctgaagaagaaagactttgagctcaacgcgctcaacgctcgaattgaagacgaacaa
gcagttgctggccagcttcagaagaagctcaaagagctccaggcacgaatcgaggagctg
gaggaggagctggaggcggagcggacgggccgggccaaggtggagaagctgcgctcggat
ctgtcacgggagctggaggagatcagcgagcggctggaggaggcgggcggagccacctca
gtgcagctcgagctcaacaagaagagggaggctgagttccagaagctgcggcgagacctg
gaggaggcaacgctgcagcacgaggccacggccgccgccctgcgcaagaagcacgccgac
agcgtggctgagctgagcgagcagctcgacaacctgcagcgcgtcaagcagaagctggag
aaggagaagagcgagctgaagctggagctggacgacgtcagctccaacatggagcagctc
atcaaggccaaggccaacctggagaagatgtgccgcaccacggaggaccagatgaatgag
caccgcagcaaatcagaggaggcgcagcgtatggttgctgacctcagcacccagcgagcc
aagctccagacggagaacggtgagctctcaaggcagctggaggagaaggaagccttcatc
aaccagctgatgcgtgggaaactcacctacactcagcagctggaggacctgaagaggcag
ctggaggaggaagccaaggccaagaacgcgctggcccacgccctgcagtcagcccggcac
gactgtgacctgctgagggagcagtatgaagaggagatggaggccagggctgagctgcag
cgtgccctctccaaagccaacttggaggtggcccagtggaggaccaagtatgagacggac
gccatccaacgcaccgaggagttggaggaggccaagaagaagctggcgcagcggctgcag
gaagccgaggaggcggtggaggcggtcaacgccaaatgctcctccctggagaagaccaag
caccggctgcagaatgagatcgaggacctgatggcggacctggagaggtcaaacgctgcg
gctgccgctctggataagaagcaaaggaactttgataagatcttgtcggagtggaagcag
aagttcgaggagtcgcagacggagctggaggcggcgcagaaggagtcccggtccctcagc
actgagctcttcaagctgaagaacgcctacgaggagtcgctggagcacctggagaccttc
aagagggaggccaagaacctccaagaggagatctcggacttgacggagcagctgggagcc
ggccacaagaccatccacgagctggagaaggtccgtaagcagctggacgccgagaagctg
gagctgcaagcagcgctggaggaggccgaggcgtccctggaacacgaggaggggaagatc
ctgagggcccagctggagttcaaccaagtgaaggcggactacgagcgcaagctggcggag
aaggaggaggagatggagcaggccaagcggaaccacctgcgggtggtggactcactgcag
acgtcgctggacgccgagacgcggagccgcaacgaagcgctgaggctgaagaagaagatg
gagggcgacctcaacgagatggagatccaactgagccacgccaaccgcatggcagccgag
gcccagaagcaagtcaaggcgctgcagggctacctcaaggtacccctgggacccccccgt
ggggggggggctgttgggtgggctgaagttggctgctgggtgggtatacagttcccagtg
ggaaatggtcgggtgggcgttgtgggggtttctttggtgcccgatgggcgcccgttggct
gctcaatgggcggccgttggtcgcccattttgtgcccagttggttatccctccgtggcca
ttggctgcccaatgggctgccggttggtga

DBGET integrated database retrieval system