KEGG   Gallus gallus (chicken): 395707
Entry
395707            CDS       T01006                                 

Gene name
ATP2A3
Definition
(RefSeq) sarcoplasmic/endoplasmic reticulum calcium ATPase 3
  KO
K05853  P-type Ca2+ transporter type 2A [EC:7.2.2.10]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04020  Calcium signaling pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    395707 (ATP2A3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    395707 (ATP2A3)
   04261 Adrenergic signaling in cardiomyocytes
    395707 (ATP2A3)
Enzymes [BR:gga01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     395707 (ATP2A3)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Cation_ATPase_N Hydrolase Hydrolase_3 HAD
Other DBs
NCBI-GeneID: 395707
NCBI-ProteinID: NP_990222
CGNC: 1084
Ensembl: ENSGALG00000001564
UniProt: Q9YGL9
Position
19
AA seq 1042 aa
MEAAHSVPVQDVLSRFGVAESCGLSPEQVRRNREKYGPNELPAEERKSLWELVLEQFEDL
LVRILLMAAFLSFILAWFEEGEESTTAFVEPIVIIMILIANAVVGVWQERNAESAIEALK
EYEPEMGKVIRADRSGVQRIRARDIVPGDIVEVAVGDKVPADIRIIEIRSTTLRVDQSIL
TGESMSVIKHADPIPDPRAVNQDKKNMLFSGTNIAAGKAVGIVIATGVYTEIGKIRNQMV
ETEPEKTPLQQKLDEFSQQLSKVIFLVCIAVWVINISHFSDPVHGGSWFRGAIYYFKTSV
ALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQ
MSVCRMFIMEKVEGTQCSLHEFSITGSTYAPEGQILKDEKPVRCGQYDGLVELATICALC
NDSSLDYNESKKVYEKVGEATETALTCLVEKMNVFDTDTSKLSKVERANACNSVIKHLMR
KECTLEFSRDRKSMSVYCTPTGPGHNSAGSKMFVKGAPESVIERCTHVRVGTAKVPLTPP
VREKILSQIRDWGMGTDTLRCLALATHDAPVQRETMQLHDSTTFTHYETNLTFVGCVGML
DPPRKEVTSSIEMCRKAGIRVIMITGDNKGTAVAICRRIGIFTESEDVAGKAYTGREFDE
LSPEAQRQACREARCFARVEPAHKSRIVEYLQSFNEITAMTGDGVNDAPALKKAEIGIAM
GSGTAVAKSAAEMVLSDDNFSTIVSAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAI
LGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDKLPRNPKEPLISGWLFFRYLAI
GVYVGLATVGAATWWFLYDAEGPQVSFHQLRNFMRCTEDNPIFEGVNCEIFESRYPTTMA
LSVLVTIEMCNALNSVSENQSLLRMPPWLNIWLLGAIVMSMALHFFILYVKPMPLIFQVT
PLSWPQWVVVLKISLPVILLDEGLKYLSRNHLEGILRTVRNTWSGEHQLKTCRTPEQGRR
GQEMNDTKEMLQAKGPQTCNSD
NT seq 3129 nt   +upstreamnt  +downstreamnt
atggaggcagcgcacagcgtgccggtgcaggacgtgctgagccgcttcggcgtggccgag
agctgcgggctcagccccgaacaggtccgtcgcaaccgggagaagtacggccccaatgaa
ctccctgcagaagaacgaaagtccctctgggagctggtgctggagcagtttgaagatctc
ctggtccgcatccttctgatggcagcattcctctcctttatcctggcctggtttgaagaa
ggagaggagagcacaacagccttcgtggagcccatcgtcatcatcatgatcctgattgcc
aatgctgtggtgggtgtgtggcaggagaggaatgccgagagcgccatcgaggccctgaag
gagtatgagcccgaaatggggaaggtgatccgtgccgaccgcagtggggtgcagcggatt
cgcgctcgtgacatcgtccccggggacatcgtggaggtggcagttggtgacaaggtgcca
gcagacatccgcatcattgaaatccgctccaccacgctgcgggttgaccagtccatcctc
acaggggagtccatgtcggtgatcaaacacgctgaccccatccccgacccccgtgctgtc
aaccaggacaagaagaacatgcttttctctggtaccaacatcgcagctgggaaggctgtg
ggaatcgtcattgcaacaggggtgtacacagagatcgggaagatccgaaaccagatggtg
gagacagagcctgagaaaaccccgttgcagcagaagctggatgagttcagccagcagctc
tctaaagtgatcttcctggtgtgcatcgccgtttgggtcatcaacatcagccacttcagt
gaccctgtccatggtggctcctggttccgaggtgccatctactatttcaagacatcagtg
gccctggcggtggctgccattcctgagggcctcccggctgtcatcaccacatgcctggca
ctgggcacccgccgcatggccaagaagaatgccatcgtgagaagtttgccctcagtggag
acactggggtgcacctctgtcatctgctctgacaagaccggcaccctcaccaccaaccag
atgtccgtctgcaggatgttcatcatggagaaggtggagggtactcagtgcagcctgcat
gagttcagcatcaccggctccacctatgcccccgagggacagatcctgaaggacgagaag
ccggtgcggtgcgggcagtacgatgggctggtggagctggctactatctgtgctctctgc
aatgattcctcactggactacaatgagtcaaaaaaagtctacgagaaggtgggggaagcc
actgaaactgccctgacgtgcttggtggaaaagatgaacgtgttcgacacggacaccagc
aagctctccaaggtggagcgagccaacgcctgcaattcagtgatcaaacatctgatgagg
aaggagtgcaccctggagttctcccgtgaccgcaagtccatgtcggtgtactgcacgccc
actggccctggtcacaactctgctggcagcaagatgtttgtcaagggtgccccagagagc
gtgattgagcgctgcacccacgtccgtgtgggcacagccaaggttccactgaccccacct
gtgagggagaagatcctgagccagatccgggactggggcatgggcactgacacgctgcgc
tgcctggcattggccacccatgatgcacccgtccagagggagaccatgcagttgcacgac
tccaccaccttcacccactatgagaccaatctgacctttgtgggctgcgtggggatgctg
gaccctccccgcaaggaggtcacttcctccattgagatgtgccgcaaggccggcatccgc
gtcatcatgatcacgggcgacaacaagggcacggcggtggccatctgccgccgcatcggc
atcttcacagagagcgaggatgtggctggcaaggcatacacgggccgggagttcgatgag
ctgtccccagaggcacagcggcaggcgtgtcgtgaggctcgctgcttcgcccgcgttgag
ccggcgcacaagtcccgcatcgttgagtacctgcagtccttcaatgagatcaccgccatg
acgggcgatggcgtcaacgatgccccagccctgaagaaagcagagattggcatcgccatg
gggtccggcacggctgttgccaagtcagccgctgagatggtgctctctgacgacaacttc
tccaccatcgtgtcggccgtggaggagggcagagccatctacaacaacatgaagcagttc
atccgctatctcatctcctccaacgtcggggaggttgtgtgcatcttcctgacagccatc
ctgggcctgcccgaagccctcatcccagtgcagctgctgtgggtgaacctggtgacagat
ggactgccagccaccgcactgggattcaacccccctgatctggacatcatggacaagctg
ccgcgcaaccccaaggagcctcttatcagtggatggctcttcttccgttacctggccatt
ggagtgtacgtggggctggccacggtgggcgcagcgacctggtggttcttgtatgacgct
gagggaccgcaggtctccttccatcagttgaggaacttcatgcgatgcaccgaagacaac
cccatcttcgaaggagttaactgtgaaatcttcgagtctcgatacccaaccacgatggct
ctgtctgtgctggtgacaatcgaaatgtgcaatgctctgaacagtgtctctgagaaccag
tcactgctgcgaatgcccccatggctcaacatctggctgctgggggccatcgtcatgtcc
atggctctgcacttcttcatcctctacgtcaagcccatgcctctcatcttccaagtgacc
ccgctgagctggccgcagtgggtggttgtcctgaagatctccctgcccgtcatcctgctc
gacgaaggactcaagtacctttcccgtaaccacctggaggggattctcaggacagtaaga
aacacgtggagcggggagcaccagttgaaaacctgcaggactccagagcaagggagaaga
ggacaagaaatgaatgacacgaaggagatgctccaggctaaaggaccccaaacgtgtaac
tcggactga

KEGG   Gallus gallus (chicken): 396446
Entry
396446            CDS       T01006                                 

Gene name
ATP2A2
Definition
(RefSeq) sarcoplasmic/endoplasmic reticulum calcium ATPase 2 isoform 2
  KO
K05853  P-type Ca2+ transporter type 2A [EC:7.2.2.10]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04020  Calcium signaling pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    396446 (ATP2A2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    396446 (ATP2A2)
   04261 Adrenergic signaling in cardiomyocytes
    396446 (ATP2A2)
Enzymes [BR:gga01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     396446 (ATP2A2)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3 HAD
Other DBs
NCBI-GeneID: 396446
NCBI-ProteinID: NP_001258903
CGNC: 49809
Ensembl: ENSGALG00000032287
UniProt: Q03669 A0A1L1RKB7
Position
15
AA seq 1042 aa
MENAHTKTVEEVLAYFGVNESTGLSLEQVKKLKEKWGSNELPAEEGKTLLELVIEQFEDL
LVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILVANAIVGVWQERNAENAIEALK
EYEPEMGKVYRQDRKSVQRIKARDIVPGDIVEVAVGDKVPADIRITSIKSTTLRVDQSIL
TGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAMGVVIATGVNTEIGKIRDEMV
ATEQERTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWIRGAIYYFKIAV
ALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQ
MSVCRMFILDKVEGDSCSLNEFTVTGSTYAPMGEVHKDDKLIKCSQYDGLVELATICALC
NDSSLDYNEAKGVYEKVGEATETALTCLVEKMNVFDTDLKGLSRIERANACNSVIKQLMK
KEFTLEFSRDRKSMSVYCTPNKPSRTSMSKMFVKGAPEGVIDRCTHVRVGNAKIPLSSGI
KQKIMSVIREWGTGRDTLRCLALATHDNPPRKEEMNLEDSSNFINYETNLTFVGCVGMLD
PPRIEVASSIKLCKQAGIRVIMITGDNKGTAVAICRRIGIFVEDEDVSTKAFTGREFDEL
SLAAQRDACHHARCFARVEPSHKSKIVEFLQSFDEITAMTGDGVNDAPALKKAEIGIAMG
SGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAAL
GFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIG
CYVGAATVGAAAWWFIAADGGPRVTFYQLSHFLQCKEDNPDFSGVDCVVFESPYPMTMAL
SVLVTIEMCNALNSLSENQSLMRMPPWENIWLVGAICLSMSLHFLILYVEPLPIIFQITP
LNVTQWLMVLKISLPVILLDETLKYVARNYLEPGKDSVQPATKPCSLSACTEGVSWPFVF
ITLPLVIWLYSTDTNFSDMFWS
NT seq 3129 nt   +upstreamnt  +downstreamnt
atggagaacgcgcacacaaagactgtggaggaagttttggcgtatttcggggtcaacgaa
agcaccgggctcagcctggagcaagtgaagaagctgaaggagaaatggggctccaacgag
ttaccagctgaggaaggaaaaaccttacttgagcttgtgattgaacaatttgaagactta
ctagttagaattctgttgctggcagcttgcatatcttttgtgctggcctggtttgaagaa
ggtgaagaaacaatcacagcgtttgtagagccttttgtaatcttacttatattagtagcc
aatgcaattgtgggagtgtggcaggaaagaaatgctgaaaatgctattgaagctcttaaa
gaatatgaaccagaaatgggtaaagtgtatcgacaagatcggaagagcgttcagagaatc
aaagcaagagacattgtcccaggtgatattgtggaagtggcagttggagacaaggttcct
gctgatataagaatcacttctatcaaatctacaactctaagggtagaccagtccattctc
acaggtgaatctgtgtctgttattaagcacactgatcctgtacccgatcctcgtgctgta
aatcaagacaagaagaacatgcttttttctggtactaacattgctgctggtaaagctatg
ggagtggtaattgcaacaggagtcaacaccgaaattggcaaaattcgtgatgagatggtg
gctactgaacaagagagaaccccactccaacaaaagctggatgagtttggagagcagctg
tctaaagtcatctcgcttatctgcattgctgtttggataataaacatcggtcacttcaat
gatccggttcatggtggctcctggattcgaggtgctatctattactttaagattgctgtt
gctcttgctgttgctgctattcctgaaggcctacctgctgttattaccacctgcttggct
cttggaacccgcagaatggccaagaagaatgcaattgttagaagtcttccctccgtggaa
accttgggttgcacctcagttatttgttctgacaagactggtactctgaccaccaatcag
atgtcagtctgcaggatgttcatcctggacaaagtagaaggagatagctgttctctgaat
gaatttactgtaactggttcgacatacgctcccatgggagaagtgcataaagatgacaaa
cttattaaatgtagtcagtatgatggccttgtggaactggcaacgatctgtgcgctctgt
aacgattcctctttggattacaatgaagcaaagggagtatatgaaaaagttggtgaagcc
acagaaacagcacttacctgtctggttgaaaagatgaatgtatttgacacagacttgaaa
ggactttcacgaattgaacgtgcaaatgcttgcaactcggtgataaaacaacttatgaag
aaggaattcactctggaattctcaagagacagaaaatcaatgtctgtctattgtacacca
aacaaaccgagccgcacatccatgagcaagatgtttgttaagggtgcccctgaaggtgta
atcgatagatgtacacatgtccgtgttggaaacgccaaaataccattatcctcaggaatt
aagcagaaaataatgtctgttattagagagtggggaactggtagagacacactgcgttgt
ttggctctggcaacacacgacaatcctcctaggaaagaagaaatgaatcttgaggactcc
tcaaacttcattaactatgagaccaatctgacctttgtgggctgcgtgggaatgctggat
cccccaagaattgaagtagcttcctctataaagctgtgtaaacaagctggtattagagtg
attatgattactggtgacaataaaggcacagcagtggccatttgccgacgcattggtatc
tttgtggaagatgaggacgtttctaccaaagcttttactggccgtgaattcgacgagctc
tcactcgctgcccaaagagatgcttgccaccatgcccgctgctttgcccgcgtggagcct
tctcacaaatctaaaattgtagagttccttcagtcttttgatgagattacagctatgact
ggtgatggtgtcaacgatgcccctgcattgaagaaagcggaaattgggatcgctatgggc
tctggtactgcagtggctaaaactgcttctgaaatggttttagcagatgataatttttca
actattgtagctgctgtggaagaagggcgtgcaatttacaacaacatgaagcagttcatc
cgttacttgatttcttccaatgttggagaagttgtttgcatcttcttgactgctgccctg
ggttttcctgaagctctgatccctgtccagctgttatgggtgaaccttgtgacggatggt
ctccctgctactgctctgggctttaatcctcctgatctcgatatcatgaacaaaccaccc
cgcaaccctaaggagccactgatcagtgggtggctcttcttccgctacctggcaattgga
tgttacgttggtgctgccactgtgggtgctgctgcttggtggtttattgctgctgatggt
ggtccaagagttaccttttaccagctgagccattttctgcagtgcaaagaggacaaccca
gacttttctggtgtcgactgtgtggtttttgagtctccatatccaatgacaatggctctc
tctgtacttgtcaccatagagatgtgcaatgccctcaacagtctgtcagaaaatcagtcc
ctaatgaggatgcctccatgggagaatatctggctggtgggagcgatttgcttgtccatg
tcactccacttccttatcctctatgtggaaccgctgccgattatcttccagatcacgcct
ttaaacgtgacgcaatggctgatggtattgaaaatctcactacctgtcattctgctggat
gaaacacttaaatacgtggcccgtaactacctggaacctggtaaagatagtgtgcagcct
gccaccaaaccgtgttctttgtcagcatgcaccgaaggagtttcctggccctttgtgttc
attaccctgcccttggttatctggctgtacagcacagacactaactttagtgatatgttc
tggtcttga

DBGET integrated database retrieval system