KEGG   Gallus gallus (chicken): 395855
Entry
395855            CDS       T01006                                 

Gene name
CALM2
Definition
(RefSeq) calmodulin
  KO
K02183  calmodulin
Organism
gga  Gallus gallus (chicken)
Pathway
gga04020  Calcium signaling pathway
gga04070  Phosphatidylinositol signaling system
gga04114  Oocyte meiosis
gga04218  Cellular senescence
gga04261  Adrenergic signaling in cardiomyocytes
gga04270  Vascular smooth muscle contraction
gga04371  Apelin signaling pathway
gga04625  C-type lectin receptor signaling pathway
gga04744  Phototransduction
gga04910  Insulin signaling pathway
gga04912  GnRH signaling pathway
gga04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    395855 (CALM2)
   04020 Calcium signaling pathway
    395855 (CALM2)
   04070 Phosphatidylinositol signaling system
    395855 (CALM2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    395855 (CALM2)
   04218 Cellular senescence
    395855 (CALM2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    395855 (CALM2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    395855 (CALM2)
   04912 GnRH signaling pathway
    395855 (CALM2)
   04916 Melanogenesis
    395855 (CALM2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    395855 (CALM2)
   04270 Vascular smooth muscle contraction
    395855 (CALM2)
  09157 Sensory system
   04744 Phototransduction
    395855 (CALM2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gga01009]
    395855 (CALM2)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    395855 (CALM2)
   03036 Chromosome and associated proteins [BR:gga03036]
    395855 (CALM2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    395855 (CALM2)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     395855 (CALM2)
Membrane trafficking [BR:gga04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    395855 (CALM2)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Centriole replication proteins
     395855 (CALM2)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   395855 (CALM2)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 EF-hand_4 SPARC_Ca_bdg EF-hand_11 UPF0154 EFhand_Ca_insen DUF1103 Caleosin Dockerin_1 DUF5580 TerB SurA_N_2 Poly_export DUF2267 RTX_C DUF6279 MecA_N Fe_hyd_lg_C
Other DBs
NCBI-GeneID: 395855
NCBI-ProteinID: NP_990336
CGNC: 49513
Ensembl: ENSGALG00000010023
UniProt: O93410
Structure
PDB: 
2VB6 2M3S

Position
3
AA seq 149 aa
MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG
NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE
QVDEMIRESDIDGDGQVNYEEFVQMMTAK
NT seq 450 nt   +upstreamnt  +downstreamnt
atggctgatcaactgacagaagagcagattgcagaattcaaagaagctttttcactattt
gacaaggatggtgatggtactataactacaaaggagttggggactgtgatgagatcactt
ggtcagaaccccacagaagcagaattacaggacatgatcaatgaagtagacgctgatggc
aatggcacaattgacttcccagagtttctgacaatgatggcaagaaaaatgaaagataca
gatagcgaagaagaaattagagaagcgttccgtgtgtttgacaaggatggtaatggttac
attagtgctgcagaacttcgtcatgtgatgacaaatcttggggagaagctaacagatgaa
caagttgatgaaatgattagggaatcagacattgatggtgatggtcaagtaaactatgaa
gagtttgtacaaatgatgacagcgaagtga

KEGG   Gallus gallus (chicken): 396523
Entry
396523            CDS       T01006                                 

Gene name
CALM1
Definition
(RefSeq) neo-calmodulin
  KO
K02183  calmodulin
Organism
gga  Gallus gallus (chicken)
Pathway
gga04020  Calcium signaling pathway
gga04070  Phosphatidylinositol signaling system
gga04114  Oocyte meiosis
gga04218  Cellular senescence
gga04261  Adrenergic signaling in cardiomyocytes
gga04270  Vascular smooth muscle contraction
gga04371  Apelin signaling pathway
gga04625  C-type lectin receptor signaling pathway
gga04744  Phototransduction
gga04910  Insulin signaling pathway
gga04912  GnRH signaling pathway
gga04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    396523 (CALM1)
   04020 Calcium signaling pathway
    396523 (CALM1)
   04070 Phosphatidylinositol signaling system
    396523 (CALM1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    396523 (CALM1)
   04218 Cellular senescence
    396523 (CALM1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    396523 (CALM1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    396523 (CALM1)
   04912 GnRH signaling pathway
    396523 (CALM1)
   04916 Melanogenesis
    396523 (CALM1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    396523 (CALM1)
   04270 Vascular smooth muscle contraction
    396523 (CALM1)
  09157 Sensory system
   04744 Phototransduction
    396523 (CALM1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gga01009]
    396523 (CALM1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    396523 (CALM1)
   03036 Chromosome and associated proteins [BR:gga03036]
    396523 (CALM1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    396523 (CALM1)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     396523 (CALM1)
Membrane trafficking [BR:gga04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    396523 (CALM1)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Centriole replication proteins
     396523 (CALM1)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   396523 (CALM1)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 EF-hand_4 SPARC_Ca_bdg EF-hand_11 UPF0154 EFhand_Ca_insen Caleosin Dockerin_1 TerB DUF5580 SurA_N_2 DUF1103 Poly_export DUF2267 SurA_N_3 MotA_activ Fe_hyd_lg_C
Other DBs
NCBI-GeneID: 396523
NCBI-ProteinID: NP_001103834
CGNC: 49852
Ensembl: ENSGALG00000026445
UniProt: P05419
Structure
PDB: 

Position
5
AA seq 149 aa
MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG
NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDSNGYISAAELRHVMTNLGEKLTDE
EVDEMIREADIDGDGQVNYEEFVQMMTAK
NT seq 450 nt   +upstreamnt  +downstreamnt
atggctgaccagctgaccgaagagcagattgctgaattcaaggaagccttttccctattt
gacaaagatggtgatggtactatcacaacaaaagaactgggaactgtcatgaggtcgctg
ggtcaaaatccaacagaagcagaattacaggatatgatcaacgaggtagatgctgatggt
aatggcactattgactttcctgaatttttaaccatgatggccagaaaaatgaaggacaca
gacagcgaggaagaaatccgtgaggcattccgagtctttgacaaggatagcaatggctat
atcagtgcagcagagctacgtcatgttatgacaaacttaggagaaaagctaacagacgaa
gaagtagatgaaatgatcagagaagcagacattgatggggatggacaagtcaactatgaa
gaattcgtacagatgatgactgcaaagtga

KEGG   Gallus gallus (chicken): 416692
Entry
416692            CDS       T01006                                 

Gene name
CALML3
Definition
(RefSeq) calmodulin, striated muscle
  KO
K02183  calmodulin
Organism
gga  Gallus gallus (chicken)
Pathway
gga04020  Calcium signaling pathway
gga04070  Phosphatidylinositol signaling system
gga04114  Oocyte meiosis
gga04218  Cellular senescence
gga04261  Adrenergic signaling in cardiomyocytes
gga04270  Vascular smooth muscle contraction
gga04371  Apelin signaling pathway
gga04625  C-type lectin receptor signaling pathway
gga04744  Phototransduction
gga04910  Insulin signaling pathway
gga04912  GnRH signaling pathway
gga04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    416692 (CALML3)
   04020 Calcium signaling pathway
    416692 (CALML3)
   04070 Phosphatidylinositol signaling system
    416692 (CALML3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    416692 (CALML3)
   04218 Cellular senescence
    416692 (CALML3)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    416692 (CALML3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    416692 (CALML3)
   04912 GnRH signaling pathway
    416692 (CALML3)
   04916 Melanogenesis
    416692 (CALML3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    416692 (CALML3)
   04270 Vascular smooth muscle contraction
    416692 (CALML3)
  09157 Sensory system
   04744 Phototransduction
    416692 (CALML3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gga01009]
    416692 (CALML3)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    416692 (CALML3)
   03036 Chromosome and associated proteins [BR:gga03036]
    416692 (CALML3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    416692 (CALML3)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     416692 (CALML3)
Membrane trafficking [BR:gga04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    416692 (CALML3)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Centriole replication proteins
     416692 (CALML3)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   416692 (CALML3)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 EF-hand_4 SPARC_Ca_bdg EF-hand_11 EFhand_Ca_insen UPF0154 Caleosin Dockerin_1 SurA_N_2 DUF2267 DUF5580 Fe_hyd_lg_C SurA_N_3 MotA_activ
Other DBs
NCBI-GeneID: 416692
NCBI-ProteinID: NP_001075166
CGNC: 50326
Ensembl: ENSGALG00000008424
UniProt: F1P596
Position
1
AA seq 149 aa
MAERLSEEQIAEFKEAFSLFDRDGDGCITTKELGTVMRSLGQNPTEAELQDMVGEVDADG
SGTIDFPEFLSLMARKMRDSDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE
EVDEMIKEADCNNDGQVNYEEFVRMMTEK
NT seq 450 nt   +upstreamnt  +downstreamnt
atggccgagcggctgtcggaggagcagatcgctgaattcaaggaggctttttcccttttt
gaccgcgacggcgatggctgcatcaccacgaaggagctgggcactgtcatgcgctcactg
gggcagaaccccaccgaggcggagctgcaggacatggtgggagaggtggacgcggacggc
agcggcaccattgatttccccgagttcctctcgctgatggcgaggaagatgagggattca
gacagcgaggaggagatccgtgaagctttccgtgtcttcgacaaggacggtaatggttac
atcagcgcggcggagctgcggcacgtcatgaccaacctgggcgagaagctgacggacgag
gaggtggatgagatgatcaaggaggcagattgcaacaatgacgggcaggtcaactacgag
gagtttgtgaggatgatgacggagaagtga

KEGG   Gallus gallus (chicken): 427515
Entry
427515            CDS       T01006                                 

Gene name
CALML4
Definition
(RefSeq) calmodulin-like protein 4
  KO
K02183  calmodulin
Organism
gga  Gallus gallus (chicken)
Pathway
gga04020  Calcium signaling pathway
gga04070  Phosphatidylinositol signaling system
gga04114  Oocyte meiosis
gga04218  Cellular senescence
gga04261  Adrenergic signaling in cardiomyocytes
gga04270  Vascular smooth muscle contraction
gga04371  Apelin signaling pathway
gga04625  C-type lectin receptor signaling pathway
gga04744  Phototransduction
gga04910  Insulin signaling pathway
gga04912  GnRH signaling pathway
gga04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    427515 (CALML4)
   04020 Calcium signaling pathway
    427515 (CALML4)
   04070 Phosphatidylinositol signaling system
    427515 (CALML4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    427515 (CALML4)
   04218 Cellular senescence
    427515 (CALML4)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    427515 (CALML4)
  09152 Endocrine system
   04910 Insulin signaling pathway
    427515 (CALML4)
   04912 GnRH signaling pathway
    427515 (CALML4)
   04916 Melanogenesis
    427515 (CALML4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    427515 (CALML4)
   04270 Vascular smooth muscle contraction
    427515 (CALML4)
  09157 Sensory system
   04744 Phototransduction
    427515 (CALML4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gga01009]
    427515 (CALML4)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    427515 (CALML4)
   03036 Chromosome and associated proteins [BR:gga03036]
    427515 (CALML4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    427515 (CALML4)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     427515 (CALML4)
Membrane trafficking [BR:gga04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    427515 (CALML4)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Centriole replication proteins
     427515 (CALML4)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   427515 (CALML4)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_8 EF-hand_9 EF-hand_11 EF-hand_5 DUF6308 DUF6042 CLAG
Other DBs
NCBI-GeneID: 427515
NCBI-ProteinID: NP_001264558
CGNC: 6040
Ensembl: ENSGALG00000007979
UniProt: F1NRU7
Position
10
AA seq 153 aa
MAKFLSQDQINEFKECFSLYDKNHKGKIRAADLLAVMRCLGVSPTPAEAQRHLHLHKIER
NAELDFSTFLNIMYRQMKQEEPEKEILTALAMIDREKRGLISAAELRAKLTRLGEKLSEE
EVDDLLKEAKIGPNGTIKYEEFTRTICLPAADY
NT seq 462 nt   +upstreamnt  +downstreamnt
atggccaagtttctgtcccaggatcaaattaatgagttcaaggagtgcttttcgctctac
gacaagaaccacaaagggaagatcagggctgcagacctgctggctgtgatgcgctgcctg
ggggtcagccccactccggctgaggctcagcggcacctgcacctgcacaagatcgagcgc
aatgcagagctggacttctccaccttcctcaacatcatgtacaggcagatgaagcaggag
gagcccgagaaggagatcctgactgcgctggccatgatcgatcgggagaagcgagggctg
atctccgccgctgagctgcgggcaaagctgacacgactgggggagaaactgtccgaagag
gaggtcgatgacctgctgaaagaagccaagatcggaccaaatggaacaatcaaatacgaa
gagttcacccgcaccatttgtctccctgcagccgattactga

DBGET integrated database retrieval system