KEGG   Gallus gallus (chicken): 396021
Entry
396021            CDS       T01006                                 

Gene name
PPP2CB
Definition
(RefSeq) serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
  KO
K04382  serine/threonine-protein phosphatase 2A catalytic subunit [EC:3.1.3.16]
Organism
gga  Gallus gallus (chicken)
Pathway
gga03015  mRNA surveillance pathway
gga04114  Oocyte meiosis
gga04136  Autophagy - other
gga04140  Autophagy - animal
gga04261  Adrenergic signaling in cardiomyocytes
gga04350  TGF-beta signaling pathway
gga04530  Tight junction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    396021 (PPP2CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    396021 (PPP2CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    396021 (PPP2CB)
   04136 Autophagy - other
    396021 (PPP2CB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    396021 (PPP2CB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    396021 (PPP2CB)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    396021 (PPP2CB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gga01009]
    396021 (PPP2CB)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:gga03019]
    396021 (PPP2CB)
   04131 Membrane trafficking [BR:gga04131]
    396021 (PPP2CB)
   03036 Chromosome and associated proteins [BR:gga03036]
    396021 (PPP2CB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    396021 (PPP2CB)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     396021 (PPP2CB)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Catalytic subunits
     396021 (PPP2CB)
Messenger RNA biogenesis [BR:gga03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     396021 (PPP2CB)
Membrane trafficking [BR:gga04131]
 Autophagy
  Other autophagy associated proteins
   Others
    396021 (PPP2CB)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     396021 (PPP2CB)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   396021 (PPP2CB)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 396021
NCBI-ProteinID: NP_990455
CGNC: 7816
Ensembl: ENSGALG00000010273
UniProt: P48463
Position
4
AA seq 309 aa
MEEKSFAKELDQWIEQLNECRQLSESQVRSLCEKAKEILTKESNVQEVRCPVTVCGDVHG
QFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHES
RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHI
RALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA
HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHV
TRRTPDYFL
NT seq 930 nt   +upstreamnt  +downstreamnt
atggaggagaagagcttcgccaaggagctggaccagtggatcgagcagctgaacgagtgc
cggcagctgagcgagagccaggtccgcagcctctgcgagaaggctaaagaaattcttaca
aaagaatcaaatgtgcaagaggtacgttgccctgtcactgtctgtggggatgtccatggc
caattccacgatcttatggaactcttcagaatcggtgggaagtctccagacacaaattac
ctgttcatgggagactatgtggacagaggctactactcggtggaaacggtgactctacta
gtagcgttaaaggtgcgttacccagagcgcattacaatactgagaggaaatcatgaaagc
agacaaattacacaagtgtatggcttttatgatgaatgtctgcggaaatacggcaatgcc
aatgtctggaagtatttcacagatctgtttgattatcttccacttacagctctagttgat
ggccagatattctgtctccacggtggcctctctccatccatagatacactggatcatatc
agggctctggaccgcctgcaggaagttccacatgagggtccaatgtgtgatctgttatgg
tcggatccagatgatcgtggcggctggggtatatctccacgtggtgccggctacacgttt
gggcaagacatttctgaaacatttaatcatgccaacggtcttacactggtctcccgcgct
caccaactcgtcatggagggttataactggtgccatgaccgaaatgtggtgaccattttc
agtgcgcccaattactgttaccgctgtgggaaccaggccgctatcatggaactagatgac
actttaaaatattccttccttcagtttgacccagcacctcgtcgtggagagcctcacgtt
acccgtcgtaccccagactacttcctataa

KEGG   Gallus gallus (chicken): 416318
Entry
416318            CDS       T01006                                 

Gene name
PPP2CA
Definition
(RefSeq) serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
  KO
K04382  serine/threonine-protein phosphatase 2A catalytic subunit [EC:3.1.3.16]
Organism
gga  Gallus gallus (chicken)
Pathway
gga03015  mRNA surveillance pathway
gga04114  Oocyte meiosis
gga04136  Autophagy - other
gga04140  Autophagy - animal
gga04261  Adrenergic signaling in cardiomyocytes
gga04350  TGF-beta signaling pathway
gga04530  Tight junction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    416318 (PPP2CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    416318 (PPP2CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    416318 (PPP2CA)
   04136 Autophagy - other
    416318 (PPP2CA)
  09143 Cell growth and death
   04114 Oocyte meiosis
    416318 (PPP2CA)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    416318 (PPP2CA)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    416318 (PPP2CA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gga01009]
    416318 (PPP2CA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:gga03019]
    416318 (PPP2CA)
   04131 Membrane trafficking [BR:gga04131]
    416318 (PPP2CA)
   03036 Chromosome and associated proteins [BR:gga03036]
    416318 (PPP2CA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    416318 (PPP2CA)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     416318 (PPP2CA)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Catalytic subunits
     416318 (PPP2CA)
Messenger RNA biogenesis [BR:gga03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     416318 (PPP2CA)
Membrane trafficking [BR:gga04131]
 Autophagy
  Other autophagy associated proteins
   Others
    416318 (PPP2CA)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     416318 (PPP2CA)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   416318 (PPP2CA)
SSDB
Motif
Pfam: Metallophos STPPase_N Glyco_hydro_65N
Other DBs
NCBI-GeneID: 416318
NCBI-ProteinID: NP_001006152
CGNC: 4870
Ensembl: ENSGALG00000006462
UniProt: Q5ZM47
Position
13
AA seq 309 aa
MEEKVFTKELDQWVEQLNECKQLSEGQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHG
QFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHES
RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHI
RALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA
HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHV
TRRTPDYFL
NT seq 930 nt   +upstreamnt  +downstreamnt
atggaggagaaggtgttcaccaaggagctcgaccagtgggtggagcagctcaacgagtgc
aagcagctgtccgaggggcaggtgaagagcctctgcgagaaggctaaagaaatcttgaca
aaagaatccaatgtacaagaagtgcgatgtcctgtcacagtgtgtggagatgtgcatgga
caatttcacgacctcatggaactcttcagaattggaggcaaatcaccagacacaaattat
ttgtttatgggggactatgttgacagaggttattactcagttgaaacagtcacgttgctt
gtagctcttaaggtccgttaccgtgaacgtatcacgattcttcgagggaaccatgaaagc
aggcagatcacacaagtatatggtttctatgacgaatgtttaagaaaatatgggaatgca
aatgtttggaagtactttacagacctttttgattaccttcctctaaccgccttggtggat
ggccagattttctgtctacatggtggcctctctccatcaatagatacgctggatcacatc
agagcacttgatcgcttgcaggaagttcctcatgagggtccaatgtgtgacttgctatgg
tcagatccagatgaccgtggtggctggggaatttctcctcgaggtgcaggttatacgttt
ggacaggatatttcagaaacctttaaccatgctaatggccttacattggtttcaagagct
catcagttggtaatggaggggtacaactggtgccatgatcggaatgtagtaacaattttc
agtgctccaaactattgttaccgttgtggcaaccaggctgcaattatggaacttgatgat
actttaaaatactcctttttgcagttcgatccagcgccgcgcagaggtgaaccgcatgtt
actcgtcgcaccccggactacttcctgtaa

KEGG   Gallus gallus (chicken): 416350
Entry
416350            CDS       T01006                                 

Gene name
PPP2R2B
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform isoform X2
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
gga  Gallus gallus (chicken)
Pathway
gga03015  mRNA surveillance pathway
gga04261  Adrenergic signaling in cardiomyocytes
gga04530  Tight junction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    416350 (PPP2R2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    416350 (PPP2R2B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    416350 (PPP2R2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gga01009]
    416350 (PPP2R2B)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:gga03019]
    416350 (PPP2R2B)
   03036 Chromosome and associated proteins [BR:gga03036]
    416350 (PPP2R2B)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     416350 (PPP2R2B)
Messenger RNA biogenesis [BR:gga03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     416350 (PPP2R2B)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     416350 (PPP2R2B)
SSDB
Other DBs
NCBI-GeneID: 416350
NCBI-ProteinID: XP_004945109
CGNC: 5710
Ensembl: ENSGALG00000007565
UniProt: F1NS72
Position
13
AA seq 449 aa
MIPGLGNLMQDVLWCFSQVKGTIDVGVTEADIISTVEFNHTGELLATGDKGGRVVIFQRE
QESKNQPHRRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAAYFLLSTNDKT
VKLWKVSERDKRPEGYNLKDEDGRLRDPSMITSLRVPVLRPMDLMVEATPRRVFANAHTY
HINSISVNSDYETYMSADDLRINLWNFEITNQSFNIVDIKPANMEELTEVITAAEFHPHH
CNTFVYSSSKGTIRLCDMRTSALCDRHAKFFEEPEDPSNRSFFSEIISSISDVKFSHSGR
YIMTRDYLTVKVWDLNMENRPIETYQVHDYLRSKLCSLYENDCIFDKFECVWNGSDSVIM
TGSYNNFFRMFDRNTKRDVTLEASRENSKPRAVLKPRKVCVGGKRRKDEISVDSLDFSKK
ILHTAWHPSENIIAVAATNNLYIFQDKVN
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgataccaggacttggaaacctcatgcaggatgtgctgtggtgcttcagtcaggtgaag
ggaactatcgatgtcggggtgacagaagctgacattatctctacagtagaattcaaccac
accggagaattgctggcaacaggggacaaggggggtcgggttgtcatatttcagcgtgag
caggagagcaagaaccagccccatcgcaggggtgagtacaatgtgtacagcactttccag
agccacgagccggagttcgattacctgaagagtttggagatcgaggagaagatcaataag
atccgatggctcccgcagcagaacgccgcctatttcctactgtccaccaatgataaaact
gtgaagctatggaaggtcagtgagcgcgacaaaaggccggaggggtacaacctgaaggat
gaggacggccgcctccgagacccctccatgatcacctcgctgcgggtgccggtgctgcgg
cccatggacctgatggtagaggccactccacgcagggtgttcgccaacgcgcatacatac
cacatcaactccatctccgtcaacagcgactacgagacctacatgtcagccgatgacctg
cggataaacctctggaactttgagatcacaaatcagagcttcaatatcgtggacatcaag
ccggccaacatggaggagctgacggaggtgatcaccgctgcagagttccacccccaccac
tgcaacaccttcgtgtacagcagcagcaaaggcaccatccggctgtgcgatatgcgcacc
tctgccctctgcgaccgccacgccaagttttttgaggagcctgaggaccccagtaaccgc
tcgttcttttctgagatcatctcctccatctctgatgtcaaattcagccacagtgggagg
tacatcatgacccgagactacctcactgtcaaggtgtgggacttgaacatggagaaccgg
cccatcgagacgtaccaggtccacgactacctgcggagcaagctgtgctcgctgtatgag
aacgactgcatcttcgacaagtttgagtgcgtgtggaacggctccgacagtgtcatcatg
actggctcctacaacaacttcttccgcatgtttgaccgcaacaccaagcgggacgtgacg
ctggaggcctcgcgggagaacagcaaaccgcgggccgtcctcaaaccccgcaaggtctgc
gtggggggcaagaggaggaaagatgagatcagcgtggacagtctggacttcagcaaaaag
atcttgcatacagcttggcacccttcggagaatatcattgctgtggcagcgacaaataac
ctgtatatattccaggacaaggttaattag

KEGG   Gallus gallus (chicken): 418670
Entry
418670            CDS       T01006                                 

Gene name
PPP2R3B
Definition
(RefSeq) serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta isoform X1
  KO
K11583  serine/threonine-protein phosphatase 2A regulatory subunit B''
Organism
gga  Gallus gallus (chicken)
Pathway
gga03015  mRNA surveillance pathway
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    418670 (PPP2R3B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    418670 (PPP2R3B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gga01009]
    418670 (PPP2R3B)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:gga03019]
    418670 (PPP2R3B)
   03036 Chromosome and associated proteins [BR:gga03036]
    418670 (PPP2R3B)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     418670 (PPP2R3B)
Messenger RNA biogenesis [BR:gga03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     418670 (PPP2R3B)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     418670 (PPP2R3B)
SSDB
Motif
Pfam: EF-hand_13 EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_5
Other DBs
NCBI-GeneID: 418670
NCBI-ProteinID: XP_004938508
CGNC: 12519
Ensembl: ENSGALG00000016702
Position
1
AA seq 581 aa
MPPGKVLQPVLKMKVDELFLCWLSQPTTQVMLKDCLRKIKNEEKTEIGNGDAGNSENERF
TTKNSNSKQSTLGDIRLPLMPFTPPQLSTSLPSATSTSLRSVSNVKGTRRSSGTRVVQTK
KEETLPPSLSQTIPTFYFPRGCPKEKVNIDAVIAKIERTFSQFPNERATLDDMGKVAKAC
DCPLYWKGPLFYCAGGERTGYVSVHKFVAMWRKILQTCYDDAAKFVHLLMNPGCNYLVQE
DFIPFLQDVVNSHPGLSFLKEASEFHSRYITTVIQRIFYTVNRSWSGKITCNELRKSNFL
QNVALLEEEADINQLTEYFSYEHFYVIYCKFWELDTDHDLYIDRKDLARHNDHAISSRMI
ERIFSGAVTRGRKAQKDGKISYADFVWFLISEEDKKTPTSIEYWFRCMDLDGDGALSMYE
LEYFYEEQCQKLDNMAIEPLPFEDCLCQMLDLVKPQYEGKITLHDLKRCKLTNVFFDTFF
NIEKYLDHEQKDQFSILRDSEGESPEVSDWEKYAAEEYDILVAEEAASDQWNDGYEAELN
PVDHQKANVLKYQMEKRPFFEMPSHLADVDLDEYDYEEDFE
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgccacctgggaaagttttacaacctgtactgaagatgaaggtggatgaactctttctg
tgctggctgagtcagcctacaactcaggtgatgctgaaggactgcttgagaaaaatcaag
aatgaggagaaaactgaaattggcaatggggatgcaggaaacagtgaaaatgagaggttc
acaactaaaaattccaattcaaagcaaagcacattaggagatatcaggctgcctttgatg
ccttttactcctcctcagctttctacttcacttccatcagcaacttcaaccagcctaagg
agcgtgtctaatgttaaaggaacacgtagatcatcaggaaccagagtagttcagacgaag
aaggaagaaactttgccaccatcgcttagtcaaaccattccaactttctattttcctcga
ggatgtcctaaggaaaaagtaaatatagatgctgtgattgccaaaattgagagaactttc
tcacagtttccaaatgagagggcaactttagatgacatggggaaagttgcaaaggcttgt
gattgcccactctactggaaaggtcctttgttttactgtgctggaggtgaacgaacagga
tatgtgtcagttcataaattcgttgcaatgtggcgaaagatacttcagacctgctatgat
gatgctgccaagtttgttcatcttctaatgaaccctggatgcaactacttagtgcaagaa
gacttcattccttttttacaagatgtggtaaatagccatcccggcctatcatttttaaaa
gaagcatctgagtttcattctcggtacattaccacagttatacagagaatattttataca
gtaaataggtcctggtctgggaaaatcacttgcaacgagctcaggaaaagcaattttttg
cagaatgtggcattattggaagaggaagctgatattaaccagctgacagagtacttctcg
tatgaacatttctatgttatctattgcaaattttgggagctggatacagaccatgacctc
tatattgatcggaaggatttagctcgacataatgatcatgcaatatcaagtagaatgata
gagaggatcttctcaggagcagtaacaagaggtagaaaagcgcaaaaagatggaaaaatt
agctatgctgattttgtctggtttttgatatctgaagaagacaagaagacaccaactagc
attgagtactggtttcgctgcatggatcttgatggagatggtgctttgtctatgtatgaa
ttagagtatttttatgaagaacagtgccaaaaattagataacatggccatagaacccttg
ccatttgaagattgtttgtgccagatgctggatctcgtgaagccacagtatgaaggaaaa
attactctgcatgatttaaagagatgtaagttgacaaatgtgttttttgatacctttttc
aacattgaaaaatacctcgaccatgaacagaaggatcaattttctattttgcgggatagt
gaaggtgaaagtccagaggtctctgactgggagaagtatgctgctgaagagtatgacatc
ttggtagcagaagaggcagcaagtgaccagtggaatgatgggtatgaagctgaactgaat
cctgtagaccatcagaaggccaacgtcctgaagtatcaaatggaaaaaagaccgttcttt
gaaatgccttcccatctggctgatgtagacttggatgaatatgactatgaagaggacttt
gagtag

KEGG   Gallus gallus (chicken): 419523
Entry
419523            CDS       T01006                                 

Gene name
PPP2R2A
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
gga  Gallus gallus (chicken)
Pathway
gga03015  mRNA surveillance pathway
gga04261  Adrenergic signaling in cardiomyocytes
gga04530  Tight junction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    419523 (PPP2R2A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    419523 (PPP2R2A)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    419523 (PPP2R2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gga01009]
    419523 (PPP2R2A)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:gga03019]
    419523 (PPP2R2A)
   03036 Chromosome and associated proteins [BR:gga03036]
    419523 (PPP2R2A)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     419523 (PPP2R2A)
Messenger RNA biogenesis [BR:gga03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     419523 (PPP2R2A)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     419523 (PPP2R2A)
SSDB
Other DBs
NCBI-GeneID: 419523
NCBI-ProteinID: NP_001026057
CGNC: 51022
Ensembl: ENSGALG00000000235
UniProt: Q5ZLP4
Position
22
AA seq 447 aa
MAGAGGGNDIQWCFSQVKGAVDDDVAEADIISTVEFNHSGELLATGDKGGRVVIFQQEQE
NKTQSHSRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQKNAAQFLLSTNDKTIK
LWKISERDKRPEGYNLKEEDGRYRDPTTVTTLRVPVFRPMDLMVEASPRRIFANAHTYHI
NSISINSDYETYLSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEFHPNSCN
TFVYSSSKGTIRLCDMRASALCDRHSKLFEEPEDPSNRSFFSEIISSISDVKFSHSGRYM
MTRDYLSVKIWDLNMENRPVETYQVHEYLRSKLCSLYENDCIFDKFECCWNGSDSIVMTG
SYNNFFRMFDRNTKRDITLEASRENNKPRTVLKPRKVCASGKRKKDEISVDSLDFNKKIL
HTAWHPKENIIAVATTNNLYIFQDKMN
NT seq 1344 nt   +upstreamnt  +downstreamnt
atggcaggagctggaggaggaaatgacattcagtggtgtttttctcaggtgaaaggcgct
gtggatgatgatgtagcagaagcggatataatttctacggtagaatttaaccattctgga
gagttgttagcaacaggagacaaaggagggcgagtcgtcatctttcaacaggagcaggag
aacaaaacccagtctcacagtaggggagaatacaatgtttacagtacctttcaaagccat
gaaccagagtttgactacttgaaaagtttagaaattgaagagaagatcaacaaaattagg
tggttaccccagaaaaatgctgctcaatttttattgtctacaaacgataaaacaataaaa
ttatggaaaatcagtgaaagggacaaaagacctgagggctataacttaaaggaagaagat
ggacggtatagggatcctactacagttacaacactacgggtgccagtatttaggcccatg
gacctcatggttgaagctagtccacgaagaatatttgccaatgctcacacgtatcacatc
aattccatctccattaatagtgattatgaaacgtacctatctgcagatgacttgcggatt
aatttgtggcacctagaaattacagacagaagttttaatattgtagatattaagcctgcc
aacatggaagagctgacagaggtgataacagctgcagagttccacccaaacagctgtaat
acatttgtatacagcagcagtaaaggaacgattcgtctctgtgatatgagagcatcagca
ctctgtgacagacattctaaattgtttgaagaaccagaagatcctagcaacagatcattt
ttctctgaaatcatctcttccatatctgatgtcaaatttagccatagtggtcgttacatg
atgactagagattatctgtcagtgaagatctgggatttaaatatggagaacagacctgtg
gaaacataccaggtgcatgaatacctcagaagtaaactttgttcactgtatgaaaacgat
tgcatttttgacaaatttgaatgctgctggaatggatcggacagcattgtcatgacagga
tcttacaacaacttcttcagaatgtttgacagaaacacaaaacgagacatcaccttagag
gcgtcacgggaaaacaacaaaccccgtaccgttctgaagccacgtaaagtatgtgcaagt
ggtaagagaaagaaggatgaaattagtgttgacagcttagacttcaacaagaagattcta
cacacggcctggcatcctaaggaaaacatcattgctgtagctactacaaacaacttgtat
atatttcaagacaaaatgaattag

KEGG   Gallus gallus (chicken): 421250
Entry
421250            CDS       T01006                                 

Gene name
PPP2R5D
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform isoform X1
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
gga  Gallus gallus (chicken)
Pathway
gga03015  mRNA surveillance pathway
gga04114  Oocyte meiosis
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    421250 (PPP2R5D)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    421250 (PPP2R5D)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    421250 (PPP2R5D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gga01009]
    421250 (PPP2R5D)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:gga03019]
    421250 (PPP2R5D)
   03036 Chromosome and associated proteins [BR:gga03036]
    421250 (PPP2R5D)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     421250 (PPP2R5D)
Messenger RNA biogenesis [BR:gga03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     421250 (PPP2R5D)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     421250 (PPP2R5D)
SSDB
Motif
Pfam: B56
Other DBs
NCBI-GeneID: 421250
NCBI-ProteinID: XP_015138893
CGNC: 6469
Position
3
AA seq 600 aa
MPYKLKKEKESPKSAKSTTKPGGGSGKDGGAENSEEAQQPQQQPQQQQQQTPSNKRPSNS
APPPTQLNKIKYSGGPQIVKKERRHSSSRFNLSKNRELQKLPALKDAPPHEREELFIQKL
RQCCVLFDFISDPLSDLKFKEVKRAGLNEMVEYITHNRDVVTEAIYPEAVIMFSVNLFRT
LPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFVLS
LLDLFDSEDPRERDFLKTILHRIYGKFLGLRAYVRRQINNIFYRFIYETEHHNGIAELLE
ILGSIINGFALPLKEEHKMFLIRVLLPLHKVKSLSVYHPQLAYCVVQFLEKDSSLTEPVI
VGLLKFWPKTHSPKEVMFLNELEEILDVIEPSEFVKVMEPLFRQLAKCVSSPHFQVAERA
LYYWNNEYIMSLISDNAAKILPIMFPALYKNSKSHWNKTIHGLIYNALKLFMEMNQKLFD
DCTQQYKAEKQKGRFRMKEREEMWQKIEELARLNPQYPMYYAPPSLPLVCCMETETPTAE
DIQLLKKTVETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTSNQEAL
NT seq 1803 nt   +upstreamnt  +downstreamnt
atgccctacaagctgaagaaggagaaggagtctccgaagtcggccaaaagcaccacaaag
cccggcggcggcagcgggaaggatggaggggctgagaattcggaagaggcccagcaacca
cagcagcagcctcagcagcagcaacaacaaacaccttcgaataagcgccccagtaacagt
gctcccccaccaacccagctaaataagatcaagtactcagggggaccccagattgtgaag
aaggagcgtcgacacagctcttctcgcttcaatctgagcaaaaaccgggaactgcaaaag
cttccagcccttaaagatgctcctccccatgaacgagaagagcttttcatccagaagctg
cggcagtgctgtgtgctttttgacttcatctctgaccctctcagtgacctgaaattcaag
gaggtgaagcgagcaggtctcaatgaaatggtggaatacatcacgcacaaccgtgatgtc
gtcactgaggccatctatcctgaagctgttattatgttttcggtgaacctcttccggaca
cttccgccatcatccaatcccacgggagcggagtttgaccctgaggaagatgagcctaca
ttagaggctgcgtggccacaccttcagctggtgtacgagttcttcctcaggttcttggag
tcacctgattttcaaccaaatatagcgaagaaatacattgaccagaagtttgtactgtct
ctgctggatctctttgacagtgaagaccccagagaacgtgacttcctaaagactattctg
cacaggatctatgggaagttcctgggtctgcgagcatatgtgagacggcagatcaacaat
atattttacaggttcatctatgaaacagagcatcacaatgggattgcagagctgctggag
atcctaggaagcataatcaatgggtttgctctgcctctgaaggaagagcacaaaatgttc
ctcatcagggtcttgttaccactgcacaaagtgaaatctctcagtgtctaccacccacag
ttggcatactgtgttgtacagttcttggagaaagacagcagcttgacagaaccggtgatt
gtgggcttgctgaagttctggccgaaaacacacagtcccaaggaggtgatgtttttaaat
gagctggaagagatcctggatgtgattgagccatctgaatttgtgaaagttatggagccc
ttgttcaggcagttggccaagtgtgtctccagcccacacttccaggtggcagagcgagca
ctgtactattggaacaacgaatatatcatgagcctgatcagcgataacgcagccaaaatt
ctcccgatcatgtttccagcgctctacaagaactccaagagtcactggaacaagacaatc
catggactgatctacaatgcactaaagctattcatggagatgaaccaaaagctttttgat
gactgcacacagcaatataaggcagagaaacagaagggaaggttcaggatgaaggaacga
gaagaaatgtggcagaaaatagaggagctggcccggctgaaccctcagtatcccatgtat
tatgcacctccatcattgcctctggtctgctgtatggaaacggagaccccgactgcagag
gatattcagctactgaagaaaacagtggagacagaggctgtgcagatgctgaaagacatt
aagaaggagaaggttttgctgcgccggaaatctgagcttcctcaggacgtctacactata
aaagccctggaggcccacaagagagcagaagagtttctcacctctaaccaggaggctctc
tga

KEGG   Gallus gallus (chicken): 421372
Entry
421372            CDS       T01006                                 

Gene name
PPP2R5A
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
gga  Gallus gallus (chicken)
Pathway
gga03015  mRNA surveillance pathway
gga04114  Oocyte meiosis
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    421372 (PPP2R5A)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    421372 (PPP2R5A)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    421372 (PPP2R5A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gga01009]
    421372 (PPP2R5A)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:gga03019]
    421372 (PPP2R5A)
   03036 Chromosome and associated proteins [BR:gga03036]
    421372 (PPP2R5A)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     421372 (PPP2R5A)
Messenger RNA biogenesis [BR:gga03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     421372 (PPP2R5A)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     421372 (PPP2R5A)
SSDB
Motif
Pfam: B56
Other DBs
NCBI-GeneID: 421372
NCBI-ProteinID: XP_419432
CGNC: 7467
Ensembl: ENSGALG00000009828
UniProt: E1C5A3
Position
3
AA seq 476 aa
MSAAISAAEKVDGFTRKSVRKAQRQKRSQGSSQFRSQSSQVELSPLPQLKDATSNEQQDL
FCQKLQQCCVLFDFMDSVSDLKGKEIKRATLNELVEYVSTNRGVIVESAYADIVKMISSN
IFRTLPPSDNPDFDPEEDEPTLEASWPHIQLVYEFFLRFLESPDFQPSIAKRFIDQKFVQ
QLLELFDSEDPRERDFLKTVLHRIYGKFLGLRAFIRKQINNIFLRFIYETEHFNGVAELL
EILGSIINGFALPLKAEHKQFLMKVLIPMHTAKGLALFHAQLAYCVVQFLEKDTTLTEPV
IRGLLKFWPKTCSQKEVMFLGEIEEILDVIEPTQFKKIEEPLFKQISKCVSSSHFQVAER
ALYFWNNEYILSLIEENIDKILPIMFGSLYKISKEHWNPTIVALVYNVLKTLMEMNGKLF
DELTSSYKAERQREKKKELEREELWRKLEELKLKKAMAEKQNSTHNVLNAHNTSAK
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgtcggcggccatctctgccgcggagaaagtggatggcttcacacggaaatcggtgcgc
aaggctcagaggcagaagcgctcgcagggctcctcgcagttccgcagccagagcagccag
gtggagctctcgccgctgccccagctcaaagatgccacctccaatgaacagcaagatctt
ttttgtcagaagttgcagcagtgttgtgtgctctttgacttcatggactctgtttcagac
ctgaaaggcaaagaaattaagagagcaacactgaatgaactggttgaatatgtttcaacg
aatcgtggagtgattgttgaatcagcttatgctgacatagtgaaaatgattagttctaat
attttcagaacacttccacctagtgataacccggattttgatccagaagaagatgagcca
actcttgaagcctcgtggccccacatacagttggtgtatgaatttttcctaagatttttg
gaaagcccggattttcagcctagtattgcaaagagattcattgaccagaaatttgtacag
cagttactggagctctttgatagtgaggacccacgagaacgtgatttcctgaagacagtt
cttcatcgaatttatggcaaattccttggtttaagagcattcatcagaaaacagatcaat
aacattttcctcaggtttatatatgaaacagagcacttcaatggtgttgctgaacttctt
gagatattaggaagtattatcaatggttttgcactgccactgaaagcggaacacaaacag
ttccttatgaaagttctgattcccatgcatactgcaaagggattagctttgtttcacgca
cagctcgcctattgtgttgtacagttcctggagaaagatacaactttaacagagcctgta
atcagaggactgctcaaattctggcccaaaacttgcagtcagaaagaggtaatgttttta
ggtgaaattgaagaaatcttagatgtaatagagccgacacaattcaaaaaaatagaagag
cctttatttaagcaaatatccaagtgtgtgtcaagttcacattttcaggttgcagaaaga
gctttgtacttttggaataatgaatatattcttagtctgattgaggagaacatcgataaa
attctaccaattatgtttggtagtttatacaagatctccaaagaacactggaacccaacc
atcgtggcactggtatataatgtgctgaaaacactgatggaaatgaacggcaagcttttt
gatgagcttaccagctcgtataaagcagaaaggcaaagagagaaaaagaaggaattggaa
cgtgaagagctgtggagaaagctagaggagttaaagctgaagaaggcgatggcagagaag
cagaacagcactcacaacgtgctcaatgcacacaatacaagtgccaaataa

KEGG   Gallus gallus (chicken): 422858
Entry
422858            CDS       T01006                                 

Gene name
PPP2R2C
Definition
(RefSeq) protein phosphatase 2, regulatory subunit B, gamma isoform X2
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
gga  Gallus gallus (chicken)
Pathway
gga03015  mRNA surveillance pathway
gga04261  Adrenergic signaling in cardiomyocytes
gga04530  Tight junction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    422858 (PPP2R2C)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    422858 (PPP2R2C)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    422858 (PPP2R2C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gga01009]
    422858 (PPP2R2C)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:gga03019]
    422858 (PPP2R2C)
   03036 Chromosome and associated proteins [BR:gga03036]
    422858 (PPP2R2C)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     422858 (PPP2R2C)
Messenger RNA biogenesis [BR:gga03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     422858 (PPP2R2C)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     422858 (PPP2R2C)
SSDB
Other DBs
NCBI-GeneID: 422858
NCBI-ProteinID: XP_003641302
CGNC: 11581
Ensembl: ENSGALG00000015531
UniProt: A0A1D5NZN8
Position
4
AA seq 447 aa
MGEDTDTRKINHSFLRDHNYVTEADIISTVEFNHTGELLATGDKGGRVVIFQREPESKNE
PYSQGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIKWLPQQNAAHSLLSTNDKTIKLWKI
TERDKRPEGYNLKDEEGKLKDLSTVTSLQVPVLKPMDLMVEVTPRRIFANGHTYHVNSIS
VNSDCETYMSADDLRINLWHLAITDRSFNIVDIKPANMEDLTEVITASEFHPHHCNLFVY
SSSKGSLRLCDMRASALCDKHSKLYEEPEDPSNRSFFSEIISSVSDVKFSHSGRYMLTRD
YLTVKVWDLNMETKPVETYQVHDYLRSKLCSLYENDCIFDKFECAWNGSDSVIMTGAYNN
FFRMFDRNTKRDVTLEASRESSKPRAILKPRRVCVGGKRRKDDISVDSLDFTKKILHTAW
HPTENIIAIAATNNLYIFQDKVNSEMH
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgggcgaggacacggacacacgaaaaattaaccacagctttcttcgagaccacaactat
gtgactgaagctgatattatttctacagttgagttcaaccacactggagaactgctggct
actggtgacaaggggggtcgggttgttatattccaaagggaacctgagagtaaaaatgag
ccttacagtcagggggagtacaatgtttacagcactttccagagccatgaacctgaattt
gattatttgaagagcttggagatagaagaaaaaataaacaagatcaagtggttaccgcag
caaaatgcagctcactcacttttatcaacaaatgataaaacaatcaagttatggaaaatt
actgaaagagataagaggccagaggggtacaacttaaaagatgaagaaggaaagcttaaa
gatctttctacagtaacatcactacaggtgcctgtactgaaacctatggatttgatggta
gaagtcactccccggagaatctttgctaatggtcacacctatcatgtcaactcaatatct
gtcaacagtgactgtgagacatacatgtcagcggatgatctcaggattaatctctggcat
ttagcaatcacagatagaagcttcaacattgtagatataaagccagccaatatggaggac
ctgacagaagtaattacagcctctgagtttcatccccatcactgcaatctctttgtctac
agcagcagcaaaggctccctgagactctgtgacatgagagcatcagccctctgtgacaaa
cattccaagctttatgaagaaccagaagaccccagtaacagatcatttttttcagaaatt
atctcttcagtgtcagatgtcaaattcagtcacagcggtagatacatgctaacaagagat
tacctcactgtcaaggtttgggatctgaacatggaaacaaagcctgtagaaacgtaccag
gttcacgattaccttaggagcaagttgtgttccctctatgaaaacgactgcatctttgac
aagtttgaatgtgcatggaatggatcagacagtgtcatcatgacaggtgcatataacaac
ttctttcgaatgtttgaccgaaacaccaagcgggatgttaccttggaggcatcccgggag
agcagcaaaccccgcgctattctcaagcctcggagagtctgtgtgggtggcaaacggagg
aaagatgacatcagtgtcgacagtttggactttactaagaagatcttgcacacagcgtgg
cacccgaccgagaacatcattgctatagcagcgacaaacaatctctacatatttcaggat
aaagtgaactcagaaatgcactag

KEGG   Gallus gallus (chicken): 423324
Entry
423324            CDS       T01006                                 

Gene name
PPP2R3C
Definition
(RefSeq) serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma isoform X2
  KO
K11583  serine/threonine-protein phosphatase 2A regulatory subunit B''
Organism
gga  Gallus gallus (chicken)
Pathway
gga03015  mRNA surveillance pathway
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    423324 (PPP2R3C)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    423324 (PPP2R3C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gga01009]
    423324 (PPP2R3C)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:gga03019]
    423324 (PPP2R3C)
   03036 Chromosome and associated proteins [BR:gga03036]
    423324 (PPP2R3C)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     423324 (PPP2R3C)
Messenger RNA biogenesis [BR:gga03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     423324 (PPP2R3C)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     423324 (PPP2R3C)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_6 EF-hand_13 EF-hand_1 EF-hand_5
Other DBs
NCBI-GeneID: 423324
NCBI-ProteinID: XP_025006850
CGNC: 7643
Ensembl: ENSGALG00000010052
Position
5
AA seq 343 aa
MIGEEAMINYENFLKVGEKAGPKCKQFFTAKIFAKLLHNDPYGRISIMQFFNYVMRKVWL
HQTRIGLSLYDVAGQGYLRESDLENYILELIPTLPQLDGLEKSFYSFYVCTAVRKFFFFL
DPLRTGKIKIQDILACSFLDDLLELRDEELSKESQETNWFSAPSALRVYGQYLNLDKDHN
GMLSKEELSRYGTGTLTNIFLDRVFQECLTYDGEMDYKTYLDFVLALENRKEPAALQYIF
KLLDIENKGYLNVFSLNYFFRAIQEQMKIHGQEPVSFQDVKDEIFDMVKPKDPYKISLQD
LINSSQGDTVTSILIDLNGFWTYENREVLVASDNDSVADADDT
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgattggggaagaagcaatgattaactatgagaacttcttgaaagttggtgaaaaagct
ggacctaaatgcaagcagttcttcacagcaaagatttttgctaaattactccataatgat
ccttatgggaggatatctatcatgcagtttttcaattatgtcatgcgaaaagtgtggctt
catcagacaaggataggtctcagtttatatgatgtggcaggacagggctacctcagagaa
tcagatttagaaaactacattttagaactcatccctactttgccacaactggatggctta
gaaaaatctttttactccttctatgtctgcacagcagttagaaagttcttcttctttctg
gatcctctcagaacagggaagataaagatacaggacattttagcttgcagcttcctggat
gacttactggagttaagggatgaagaactttctaaagaaagtcaggaaacaaattggttt
tctgctccttccgcacttagagtttatggacagtacttaaaccttgataaagatcacaat
ggcatgctcagcaaagaagagctgtcccggtatggaacggggacgctgaccaacatattt
ctggaccgcgtctttcaggaatgcttaacttatgatggagaaatggactataaaacctac
ctggactttgtacttgcattagaaaacagaaaggagcctgcagctttgcaatatattttc
aaactgcttgacattgagaacaaaggatacctgaatgtcttttcccttaattatttcttt
agggctattcaggaacaaatgaaaatccatggacaagaaccagtttcttttcaggatgtc
aaggatgagatctttgatatggtaaagcctaaagatccttacaaaatctcccttcaagat
ttaatcaatagcagtcaaggagacactgttaccagtattctaattgatctgaatgggttc
tggacatatgagaacagagaggtccttgtggcaagtgataatgacagcgttgctgatgct
gatgatacgtga

KEGG   Gallus gallus (chicken): 423460
Entry
423460            CDS       T01006                                 

Gene name
PPP2R5C
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
gga  Gallus gallus (chicken)
Pathway
gga03015  mRNA surveillance pathway
gga04114  Oocyte meiosis
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    423460 (PPP2R5C)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    423460 (PPP2R5C)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    423460 (PPP2R5C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gga01009]
    423460 (PPP2R5C)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:gga03019]
    423460 (PPP2R5C)
   03036 Chromosome and associated proteins [BR:gga03036]
    423460 (PPP2R5C)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     423460 (PPP2R5C)
Messenger RNA biogenesis [BR:gga03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     423460 (PPP2R5C)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     423460 (PPP2R5C)
SSDB
Motif
Pfam: B56
Other DBs
NCBI-GeneID: 423460
NCBI-ProteinID: NP_001072950
CGNC: 51972
Ensembl: ENSGALG00000029996
UniProt: Q5F3C6
Position
5
AA seq 524 aa
MLTCNRAGSRMVVDAANSNGPFQPVALLHIRDVPPADQEKLFIQKLRQCCVLFDFVSDPL
SDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFAVNMFRTLPPSSNPTGAEFDP
EEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERD
FLKTTLHRIYGKFLGLRAYIRKQINNIFYRFIYETEHHNGIAELLEILGSIINGFALPLK
EEHKIFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDSTLTEPVVMALLKYWPKTHSPK
EVMFLNELEEILDVIEPSEFVKVMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLIS
DNAAKILPIMFPSLYRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEK
LKLKEREEAWVKIENLAKSNPQYPTYSDTSLLNSPVAMETDGPLIEDLQMLKKTVKEEAC
QAQKDQKKDRPLVRRKSELPQDIYTMKALESHCRADELISHDGH
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgttgacatgtaacagagccggcagcaggatggtggttgacgcagccaattccaacggg
cccttccagcccgtggcccttttgcacatcagagatgttcctcctgctgatcaagaaaag
ctttttatccagaagttacgacaatgttgtgtactttttgactttgtttctgatccacta
agtgacctaaagtggaaggaagtaaaacgagcagctttaagtgaaatggtagaatatatc
acacacaatcgcaatgtgattacagaacctatttaccctgaagtagtacatatgtttgca
gttaatatgtttcgaacgttaccaccatcttccaatccaactggagcagaatttgatcca
gaggaagatgaaccaactttagaagctgcatggcctcacctgcagcttgtttatgaattt
ttcttaaggtttttagaatctccagatttccaacctaatatagctaagaaatatattgat
cagaagtttgtattacagcttttagagctctttgacagtgaagatccccgggaaagagat
tttcttaaaacaactcttcacagaatatatgggaaattcttaggcctgagagcttacatc
cgaaaacaaattaataatatattttataggtttatttatgaaacagagcatcacaacggc
atagcagaattactggaaatactgggaagcataattaatggatttgccttaccattaaaa
gaagagcacaaaatattcttattgaaggttttgttaccactgcacaaagtgaaatcactc
agtgtttaccatccacagctggcgtactgtgtagttcagtttttagaaaaggacagcacg
cttacagaaccagttgtaatggcactgctgaaatactggccaaagactcacagtccaaaa
gaagtcatgtttttaaatgaactagaagaaattttagatgttattgaaccatctgaattt
gtaaaagttatggagcctcttttcagacagctagccaaatgtgtgtccagtccacacttt
caggttgcagagcgtgcattatactactggaataatgagtacataatgagtttaattagt
gataatgcagcaaagattttacccatcatgtttccatccttataccggaattcaaagaca
cattggaacaagacaatacatggcttgatatacaatgctctgaaactcttcatggagatg
aaccaaaaactgttcgatgactgcacacagcaatttaaagcagaaaaactgaaagagaag
ctaaaattgaaggaacgggaagaagcatgggttaaaatagaaaatctagccaaatcaaat
ccccagtacccaacgtatagtgacacgagcttgctgaacagtccagttgcaatggaaaca
gatgggcctttaattgaagatttgcagatgctgaagaagacagtgaaagaagaggcttgt
caggcacagaaagatcagaaaaaagatcgtcctctcgtgcgacgcaagtcagaactgcct
caggatatctataccatgaaagccttggaatcacattgcagagctgatgaattaatatca
catgatgggcattaa

KEGG   Gallus gallus (chicken): 423512
Entry
423512            CDS       T01006                                 

Gene name
PPP2R5E
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform isoform X1
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
gga  Gallus gallus (chicken)
Pathway
gga03015  mRNA surveillance pathway
gga04114  Oocyte meiosis
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    423512 (PPP2R5E)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    423512 (PPP2R5E)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    423512 (PPP2R5E)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gga01009]
    423512 (PPP2R5E)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:gga03019]
    423512 (PPP2R5E)
   03036 Chromosome and associated proteins [BR:gga03036]
    423512 (PPP2R5E)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     423512 (PPP2R5E)
Messenger RNA biogenesis [BR:gga03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     423512 (PPP2R5E)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     423512 (PPP2R5E)
SSDB
Motif
Pfam: B56 Sec7_N SBF2
Other DBs
NCBI-GeneID: 423512
NCBI-ProteinID: XP_015143376
CGNC: 8975
Ensembl: ENSGALG00000011840
UniProt: F1NLM6
Position
5
AA seq 467 aa
MSSAPTTPPSVDKVDGFSRKSVRKARQKRSQSSSQFRSQGKPIELTPLPLLKDVPSSEQP
ELFLKKLQQCCVIFDFMDTLSDLKMKEYKRSTLNELVDYITISRGCLTEQTYPEVVRMVS
CNIFRTLPPSDSNEFDPEEDEPTLEASWPHLQLVYEFFIRFLESQEFQPSIAKKYIDQKF
VLQLLELFDSEDPRERDYLKTVLHRIYGKFLGLRAFIRKQINNIFLRFVYETEHFNGVAE
LLEILGSIINGFALPLKAEHKQFLVKVLIPLHTVRSLSLFHAQLAYCIVQFLEKDPSLTE
PVIRGLMKFWPKTCSQKEVMFLGELEEILDVIEPSQFVKIQEPLFKQIAKCVSSPHFQVA
ERALYYWNNEYIMSLIEENSNVILPIMFSSLYRISKEHWNPAIVALVYNVLKAFMEMNST
MFDELTATYKSDRQREKKKEKEREELWKKLEDLELKRGLRRDGIIPT
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgtcctcagcaccaactactcctccatcagtggataaagtagacggattttctcggaag
tccgtcagaaaagccagacagaagaggtcacaaagctcctcccagtttaggtctcagggc
aagcctattgagttaactcccctgcctctgctgaaagacgttccatcttcagagcagcct
gaactgttcctaaagaaacttcaacagtgctgtgtcatttttgacttcatggacacgctt
tcagaccttaaaatgaaagaatacaagcgctccactcttaatgaactggtcgactacatt
acaataagcagaggctgtttgacagagcagacttaccctgaagtagttagaatggtatct
tgcaatatcttcagaactctcccacctagtgacagcaatgaatttgatccagaggaagat
gagcccaccttggaggcatcatggccacatctacagcttgtatatgagtttttcatacga
tttttggaaagccaagaatttcagcccagcattgccaaaaagtacatagatcagaaattt
gtattgcagttgttggagctgtttgatagcgaagacccacgagaacgggactacttaaaa
acagtcttgcacagaatttatggcaagtttctgggtcttagagcatttatccgaaaacag
attaataatatttttctacgatttgtttatgaaactgaacacttcaatggcgtagctgag
ctgttggaaattttaggaagtattatcaatggttttgctttacctcttaaggcagagcat
aaacagtttctggtgaaggtgctgattcctttacatactgtcaggagtttatcactcttc
catgcacagctggcatattgcatagtacagtttctggagaaagacccctcactcacagaa
ccagtcatcagaggcttaatgaaattctggccgaaaacctgcagtcagaaagaggtcatg
ttcctaggagagctggaggaaatcttggatgtaattgaaccatcccaatttgtcaaaatc
caggaacccttgtttaaacaaattgccaagtgtgtctctagccctcattttcaggtggct
gaaagagcactgtactattggaataatgaatacatcatgagtttgatagaggagaattca
aatgtcatacttcccatcatgttttccagcctttataggatttctaaagagcactggaat
ccggctattgtggctttagtctacaatgtgttgaaggcatttatggaaatgaacagcacc
atgtttgatgagctgacagccacttacaagtcagatcgtcagcgtgagaagaagaaagaa
aaagaacgtgaagaactgtggaaaaaactggaggatttggaattaaagagaggtctcaga
cgtgatggaataattccaacttaa

KEGG   Gallus gallus (chicken): 423970
Entry
423970            CDS       T01006                                 

Gene name
PPP2R2D
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
gga  Gallus gallus (chicken)
Pathway
gga03015  mRNA surveillance pathway
gga04261  Adrenergic signaling in cardiomyocytes
gga04530  Tight junction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    423970 (PPP2R2D)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    423970 (PPP2R2D)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    423970 (PPP2R2D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gga01009]
    423970 (PPP2R2D)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:gga03019]
    423970 (PPP2R2D)
   03036 Chromosome and associated proteins [BR:gga03036]
    423970 (PPP2R2D)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     423970 (PPP2R2D)
Messenger RNA biogenesis [BR:gga03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     423970 (PPP2R2D)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     423970 (PPP2R2D)
SSDB
Motif
Pfam: Y_phosphatase2
Other DBs
NCBI-GeneID: 423970
NCBI-ProteinID: NP_001006507
CGNC: 7966
Ensembl: ENSGALG00000010471
UniProt: Q5ZIY5
Position
6
AA seq 451 aa
MAGVAGGGGNGNDFQWCFSQVQGAVDEDVAEADIISTVEFNYSGDLLATGDKGGRVVIFQ
REQENKSRPHSRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAAHFLLSTND
KTIKLWKISERDKRAEGYNLKDEDGRLRDPFKITALRVPILKPMDLMVEASPRRIFANAH
TYHINSISVNSDHETYLSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEFHP
HHCNVFVYSSSKGTIRLCDMRSSALCDRHSKFFEEPEDPSSRSFFSEIISSISDVKFSHS
GRYMMTRDYLSVKVWDLNMENRPVETYQVHEYLRSKLCSLYENDCIFDKFECCWNGSDGA
IMTGSYNNFFRMFDRNTRRDITLEASRESSKPRAILKPRKVCTGGKRKKDEINVDSLDFN
KKILHTAWHPMENIIAVAATNNLYIFQDKIN
NT seq 1356 nt   +upstreamnt  +downstreamnt
atggcaggggtggcaggaggcggcggtaacggcaacgacttccagtggtgcttctcgcag
gtgcagggggccgtggacgaggacgtggcggaagctgatattatttcaacagttgaattt
aattactctggtgatcttcttgcaacaggagacaaaggtggcagagtggttatatttcaa
agggaacaagagaataaaagccgtcctcattctaggggagaatataatgtttacagtacc
ttccagagtcatgaacctgagtttgactacttgaaaagtctagaaattgaggaaaaaatt
aataaaatcaggtggttaccacaacagaatgctgctcatttcctgctgtctacaaatgat
aaaactattaaattatggaaaataagtgaaagggataaaagagccgaaggttataattta
aaagatgaagatggaagacttagggatcctttcaaaatcacagcactacgggtgccaata
ctgaaacccatggatctaatggttgaagcaagtcccagaaggatatttgcaaatgcacat
acttaccatataaactctatttcagtaaatagtgatcatgaaacgtacctttcagcagat
gacctaagaattaacctatggcatttagaaatcacagatagaagttttaatattgtagat
attaagcctgccaacatggaggagctgactgaagtgatcactgctgcagagttccacccc
caccactgtaatgtgtttgtgtacagcagcagcaaaggaaccattcggctctgcgacatg
cgctcctcagccctctgtgataggcattcaaaattttttgaagaacctgaagatcctagc
agcagatcatttttttcagaaataatatcatcaatatctgacgtaaaattcagccacagc
ggtcgctacatgatgacaagagactacctttctgttaaagtgtgggatctcaatatggaa
aacaggcctgtagagacgtatcaagttcatgagtaccttcgaagcaagctttgttccctg
tatgaaaatgactgcatcttcgacaaatttgagtgctgctggaacggttctgatggtgct
atcatgactggatcttacaacaacttctttagaatgtttgaccgcaacacacggcgggat
atcactttagaagcatccagggagagcagcaaacctcgtgccatcttaaaaccacgtaaa
gtgtgtacaggtggtaaaagaaagaaagatgaaataaatgttgacagtctggacttcaac
aagaagattcttcatacagcatggcatcccatggagaacatcattgctgtagctgccacc
aataatttgtatatattccaggacaaaattaactaa

KEGG   Gallus gallus (chicken): 424733
Entry
424733            CDS       T01006                                 

Gene name
PPP2R3A
Definition
(RefSeq) serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha isoform X2
  KO
K11583  serine/threonine-protein phosphatase 2A regulatory subunit B''
Organism
gga  Gallus gallus (chicken)
Pathway
gga03015  mRNA surveillance pathway
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    424733 (PPP2R3A)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    424733 (PPP2R3A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gga01009]
    424733 (PPP2R3A)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:gga03019]
    424733 (PPP2R3A)
   03036 Chromosome and associated proteins [BR:gga03036]
    424733 (PPP2R3A)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     424733 (PPP2R3A)
Messenger RNA biogenesis [BR:gga03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     424733 (PPP2R3A)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     424733 (PPP2R3A)
SSDB
Motif
Pfam: EF-hand_13 EF-hand_7 EF-hand_5 EF-hand_1 EF-hand_6
Other DBs
NCBI-GeneID: 424733
NCBI-ProteinID: XP_004936978
CGNC: 821
Ensembl: ENSGALG00000034512
Position
9
AA seq 1123 aa
MVNFEASLPSGIRAMAATYRLMVTTVNCYSSVVIEQHFQHTVHYCTGTCQVFKQGVACIV
AHHSVCAELSVQDANLDHKIPVSENGLALPGNEDYQQMLLNNPRIKKGSLVQASNSLKDI
TGEAINLASGKIKEFSFEKLKNSSNHVAYRKGRKVRSESFSRRSFDFDMIYGHFSNDENS
PPCGFLQSPSPVEKWQESSDAPEVSMNPMVPFSPHSFSEENFITQILEKHKLDGSSGGDI
KVCLDILLKCSEDLKKCTDIIKHCIKKKSADSVSGGNSSDPLASSEMIYMNLMRRFSSYL
KKLPFEFKPPGYKEASDLGELVNCFHGLQQTLFSPVFGDEQPPRYEDIIQLPSSNAVPVR
LPGDQCEVTSTSPSIQTSTVSFTSKSLCSISQENSVRAVKDACVLPQLPATSPSDCTSST
EVLYIEEESDGERVLEKTKRAKEKGDWESLKHSYQLPGSSDVIADVKAEPTRVGSELSHT
SEKSNLLKPVSNSVLCGSQAGVSKGEQMCKIDKDEIDKLLLDLEHFSQKMESTFRESPPK
ESEPACLQVFGWQGRPVLPVALEPKSKPIDPTYPLSKIVETNGHKMEEDDRALLLRILGS
IEDFAQELVEFQKGKGSLSKEKEVMQILQETLSTPSQSLLAAQKSYAGAASRDSVPALIQ
QAPEVIKVQSKQEKKPGRSSPVPLNSVVSPCALPVNKATSSTPLSINIPRFYFPKGLPNV
CTNHEEIIARIEEAFTEFEDEKANICEMGKIAKICGCPLYWKAPMFSASGGQRTGCVSVH
SFVSLWRKILCSCHDDASRFAYLVAKPSCGYLEQEDFIPLLQDVVETHPGLTFLKDAPEF
HSRYITTVIQRIFYTVNRSWSGKITLTELRKSNFLQTLALLEEEDDINQITDYFSYEHFY
VIYCKFWELDTDHDLYISQKDLARYSDQALSSRIIERIFSGAVVRGNEVQKEGRMSYADF
VWLLISEEDKRNATSIEYWFRCMDLDGDGVLSMYELEYFYEEQCERMEVMGIEPLPFQDL
LCQMLDLVKPEREGRVTLRDLKRCRMAHVFYNTFFNLEKYLDSEQRDPFAVQKDFENDGP
EPSDWDRYAAEEYEILVAEESGNEQLQEGNRKGMKALKRYPLL
NT seq 3372 nt   +upstreamnt  +downstreamnt
atggtgaattttgaagcctcacttccaagtgggatccgtgctatggcagcaacctacagg
cttatggtcacaactgtgaactgctacagcagcgtggtgatagaacagcactttcagcac
acagtgcattactgcacagggacttgccaggtgtttaagcaaggagttgcatgtatagtg
gcccaccacagtgtgtgtgcagaactcagtgtccaagatgccaacctagaccacaaaatt
ccagtttctgaaaatgggcttgccttgcctggaaatgaggactatcagcaaatgctccta
aataatccaagaatcaaaaagggctctttggtgcaagcttccaacagcttaaaagacatt
actggtgaggcaataaatctcgccagtggtaaaataaaggaattctcatttgagaagctc
aaaaactcttccaatcatgtggcctacagaaaggggaggaaagttcgatcagaatcattc
agcagacgatcatttgattttgacatgatttatgggcacttcagcaatgatgagaactct
cctccatgtggctttttgcagagtccctcacctgtggagaaatggcaggagagcagtgat
gctccagaagtcagtatgaatcccatggttcccttctcacctcattccttctctgaagaa
aacttcattacccaaattttggagaagcacaagctggatggttcttctggtggagatatt
aaagtgtgcttagacatcttgctcaagtgctcagaggatctgaaaaagtgcactgacata
ataaagcactgcatcaaaaagaaatcagcagacagtgttagtggagggaatagcagtgat
cctttggctagttcagaaatgatatacatgaatctgatgagaagattttcttcatacctg
aaaaagctaccctttgagttcaagccacctgggtacaaggaagcaagtgatcttggagaa
ttagtgaactgttttcatggcttgcagcaaactctattttccccagtatttggagatgag
cagccacctaggtatgaagatattattcagcttccatcctcaaatgcagttcctgtcaga
ctaccaggtgatcagtgtgaggtgacaagcacctctccgtccatccaaacaagcactgtg
agctttacctcaaaatccctttgcagcatctcacaggagaacagtgtgagagctgtgaaa
gatgcttgtgttctacctcagttaccagccacaagcccttctgactgtacatcttctact
gaggttctgtacattgaggaagagtcagatggggaaagagtgttagagaaaacaaagagg
gcaaaggagaaaggggactgggagagtttaaagcatagctaccagctacctggttcttca
gatgtgattgctgatgttaaagcagaacctaccagggtaggaagtgaactttcccacact
tctgagaaaagtaatcttttaaaaccagtttcaaattctgtattgtgtggttctcaagct
ggtgtctccaaaggtgaacagatgtgcaagatagacaaggatgaaatagataaactgctg
ctggacttggagcacttctcacagaaaatggagagtacttttagggagtctcctccaaag
gagagtgaacctgcctgtctgcaggtgtttggctggcagggtagaccagtgctacctgtg
gctcttgaacccaaaagtaaacccattgaccccacttaccctttgtcaaaaattgtggaa
accaatggtcataaaatggaagaggatgacagagcccttttactgcgtatcttgggaagc
attgaggactttgcccaggaactagtggaattccagaaaggcaagggaagcttgtccaag
gagaaagaagtgatgcaaattcttcaggaaacattatcaactccttcacagtccctcctc
gcagcacaaaaaagctatgctggggctgcctccagagactctgttccagctttgattcag
caggcaccagaagtaattaaggttcaaagtaagcaagagaagaaacctggaaggtcatcc
ccagtccccttgaactcagtggttagcccttgtgctctgcctgtgaataaagccaccagc
agtacccctttgtccataaacattccacgtttctacttccctaaaggacttccgaatgtc
tgcactaatcatgaagagatcattgccaggattgaagaagccttcacagaatttgaagat
gagaaggccaacatctgtgaaatgggaaaaattgcaaagatatgtggctgcccactttac
tggaaagcacctatgttcagtgcatcaggaggacaaaggacaggatgtgtatctgtgcac
tcatttgtgtctttgtggagaaagatcttgtgtagctgccatgatgacgcatccagattt
gcttaccttgtagcgaagcctagctgtggttaccttgagcaggaggacttcatcccactg
cttcaggatgtggtagaaacacaccctggtctgacgttcttgaaggatgctccagaattc
cattcccggtatattacaacggttatacaaagaatattctacacagtcaatcgatcctgg
tctgggaagatcaccctaacagagctgaggaaaagcaacttcttgcaaactcttgctctc
ttagaagaagaggatgacataaatcaaatcacagactacttctcctatgagcacttctat
gttatatactgtaaattctgggagctggacactgaccatgacctttatatcagccagaag
gatctggctaggtacagtgatcaagctctatcaagcaggattattgagcgaatattcagc
ggtgctgtggtgagaggaaatgaagttcagaaggaaggccgcatgagttatgctgacttt
gtgtggctgctgatttcagaggaagacaaaagaaatgctacaagcattgagtactggttt
cggtgcatggacctggatggggatggggtgctctccatgtatgaactggaatacttctat
gaggagcagtgtgaacggatggaagtgatgggcatagaaccactgccatttcaggacttg
ctgtgtcagatgctcgatcttgttaagccggagagagaaggacgagtaaccctgcgagac
ttgaagagatgcagaatggctcatgtgttctataacacgttctttaacttagagaaatac
ctggacagtgaacagagagatccctttgcagtgcaaaaggatttcgaaaatgatggccct
gaaccttctgactgggacagatatgctgctgaagagtacgagattcttgtggctgaggag
tctgggaatgaacagctccaggaaggcaacaggaagggcatgaaagccctgaagcgctat
cctctgctgtag

DBGET integrated database retrieval system