KEGG   Gallus gallus (chicken): 396032
Entry
396032            CDS       T01006                                 

Gene name
TNNC1
Definition
(RefSeq) troponin C, slow skeletal and cardiac muscles
  KO
K05865  troponin C, slow skeletal and cardiac muscles
Organism
gga  Gallus gallus (chicken)
Pathway
gga04020  Calcium signaling pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    396032 (TNNC1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    396032 (TNNC1)
   04261 Adrenergic signaling in cardiomyocytes
    396032 (TNNC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gga04812]
    396032 (TNNC1)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Troponins
     396032 (TNNC1)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_8 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_9 EF-hand_4 SPARC_Ca_bdg TerB EMG1 DUF5580
Other DBs
NCBI-GeneID: 396032
NCBI-ProteinID: NP_990464
CGNC: 49617
Ensembl: ENSGALG00000001459
UniProt: P09860
Structure
PDB: 

Position
12
AA seq 161 aa
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEM
IDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIM
LQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
NT seq 486 nt   +upstreamnt  +downstreamnt
atggatgacatctataaggcggcggttgagcagttgacagaagaacaaaaaaatgagttt
aaggctgccttcgacatcttcgtgctgggggcagaggatggctgcatcagcaccaaggag
ctggggaaggtgatgaggatgctggggcagaaccccacccctgaggagctgcaggagatg
attgatgaggtggatgaggatggcagtggcactgtggactttgatgagttccttgttatg
atggttcggtgtatgaaagatgacagcaaaggaaaaactgaagaggagctctcagatctc
ttcaggatgtttgataagaatgctgatggctacatcgatcttgaggaactgaagatcatg
ctacaggcaactggagagacgatcactgaggatgacatagaagaactgatgaaagatggc
gacaaaaacaatgatggcaggattgactatgacgagttcctggagttcatgaagggagtt
gaataa

DBGET integrated database retrieval system