KEGG   Gallus gallus (chicken): 396065
Entry
396065            CDS       T01006                                 

Gene name
AGTR1
Definition
(RefSeq) type-1 angiotensin II receptor
  KO
K04166  angiotensin II receptor type 1
Organism
gga  Gallus gallus (chicken)
Pathway
gga04020  Calcium signaling pathway
gga04080  Neuroactive ligand-receptor interaction
gga04261  Adrenergic signaling in cardiomyocytes
gga04270  Vascular smooth muscle contraction
gga04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    396065 (AGTR1)
   04020 Calcium signaling pathway
    396065 (AGTR1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    396065 (AGTR1)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    396065 (AGTR1)
   04270 Vascular smooth muscle contraction
    396065 (AGTR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    396065 (AGTR1)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:gga04030]
    396065 (AGTR1)
Membrane trafficking [BR:gga04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    396065 (AGTR1)
G protein-coupled receptors [BR:gga04030]
 Rhodopsin family
  Peptide
   Angiotensin
    396065 (AGTR1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 396065
NCBI-ProteinID: NP_990488
CGNC: 49635
Ensembl: ENSGALG00000038512
UniProt: P79785
Position
9
AA seq 359 aa
MVPNYSTEETVKRIHVDCPVSGRHSYIYIMVPTVYSIIFIIGIFGNSLVVIVIYCYMKLK
TVASIFLLNLALADLCFLITLPLWAAYTAMEYQWPFGNCLCKLASAGISFNLYASVFLLT
CLSIDRYLAIVHPVKSRIRRTMFVARVTCIVIWLLAGVASLPVIIHRNIFFAENLNMTVC
GFRYDNNNTTLRVGLGLSKNLLGFLIPFLIILTSYTLIWKTLKKAYQIQRNKTRNDDIFK
MIVAIVFFFFFSWIPHQVFTFLDVLIQLHVITDCKITDIVDTAMPFTICIAYFNNCLNPF
FYVFFGKNFKKYFLQLIKYIPPNVSTHPSLTTKMSSLSYRPPENIRLPTKKTAGSFDAE
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggtcccaaactattctaccgaagaaactgttaagagaattcacgttgattgtcctgtt
tcaggaaggcacagttacatctacattatggttccaactgtttacagtatcatcttcatc
ataggcatatttgggaacagcctggtcgttattgttatttactgctacatgaaattaaaa
acagtggccagcatctttctgctaaacctggcactggctgacttgtgttttctaataact
ctgccactctgggcagcctacacggccatggagtaccagtggccttttggcaactgttta
tgcaagctagcatcagcaggaataagtttcaatttgtacgccagtgtgttcctactcaca
tgccttagcatcgaccgctatctggccatagtgcatccagtgaagtcacgaatccgacgt
accatgtttgttgccagagtaacctgcattgtcatctggctccttgctggtgtggccagt
ttgcccgtcatcattcatcgtaatatattttttgcagagaacttgaacatgacggtctgt
ggctttcgatatgacaacaataacacaacactgagggttgggctaggtttatccaagaat
ttactgggatttttaatcccttttctcatcatactaacaagttacaccctaatttggaag
acactgaagaaggcatatcaaattcaaagaaataagaccagaaatgatgacatttttaag
atgattgtggcaatagtatttttcttcttcttttcctggattcctcatcaagtgttcact
tttctggatgtattaattcaattacatgtaataacagactgcaaaatcactgatattgtg
gatacagctatgcccttcactatctgcatcgcttacttcaacaattgcttgaatcctttt
ttttatgttttctttggaaaaaactttaaaaaatacttccttcagctaataaaatacatt
ccaccaaatgtcagcacacatccaagtctcactacaaaaatgagctccctctcgtatcga
ccaccagaaaatatacgcttgcccactaaaaagactgctgggtctttcgacgctgagtga

KEGG   Gallus gallus (chicken): 428708
Entry
428708            CDS       T01006                                 

Gene name
AGTR2
Definition
(RefSeq) type-2 angiotensin II receptor
  KO
K04167  angiotensin II receptor type 2
Organism
gga  Gallus gallus (chicken)
Pathway
gga04080  Neuroactive ligand-receptor interaction
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    428708 (AGTR2)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    428708 (AGTR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:gga04030]
    428708 (AGTR2)
G protein-coupled receptors [BR:gga04030]
 Rhodopsin family
  Peptide
   Angiotensin
    428708 (AGTR2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv
Other DBs
NCBI-GeneID: 428708
NCBI-ProteinID: XP_004940717
CGNC: 4436
Ensembl: ENSGALG00000005936
UniProt: F1NC23
Position
4
AA seq 372 aa
MQSNYSMGITTRETLQILYTAQANSSAVLRSPPPCPLTSSSYQFSLIPAFFSVVFALGLV
GNSVVVVVLCHRSSPRTVANIYIFNLAMADLLCLATLPFWATYYAQGYNWIFGSLMCKIS
SSVLCLNMFASIFFITCMSVDRYHAIVHPIRSQRRTPHQAYFIALVVWGLACLSSLPTFY
FRDTHYIKSMEVKACIMAFPHESYAEWSVGTAFLKNALGFFIPLAVITTCYVWIRRHLIQ
AQEFGKNKQKRDRVLKLVAAVVVAFLICWLPFHILTFLDALAHMNIIDNCDVTGVIDTAL
PFGICMAFANSCVNPLVYCFIGNQFQEKLHRLFKRRVYQFNSQRESSSLRKGSCFRDTEI
AVGREREPESPL
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgcagagcaactactccatgggcatcaccaccagggaaaccctccagatcctctataca
gcacaggcaaactcatcggctgtgttacgctcgccgcctccctgcccgctgacctcttcc
agttatcagttttcattaattccagcattcttctctgtggtttttgctctgggtttggtt
ggcaatagcgtggtggttgtggtgctctgtcatcgcagtagccccagaacagttgctaat
atctacattttcaacttggctatggcagatctgctgtgccttgccacccttcccttttgg
gctacctattatgcacaggggtacaactggatctttggatctctcatgtgtaaaatctcc
agctctgtcctgtgtctgaacatgtttgcaagcatatttttcatcacatgcatgagcgtg
gacaggtaccatgcaattgtccaccctatccgctcccaaagaagaactccgcatcaggcg
tattttatagcactggttgtgtggggacttgcctgtttgtcctccctcccaactttttat
ttccgtgacacacactacatcaaaagcatggaagtgaaagcttgcatcatggcatttcct
cacgagagttatgcggagtggtctgtgggaacagccttcctgaaaaatgcacttggcttc
ttcatccccttggcagtgatcaccacgtgctatgtctggatcaggaggcacctgatacaa
gcacaggagtttggcaaaaacaagcagaagagggacagagtcctaaagctggtggctgct
gttgttgtggccttcttaatttgctggctcccattccacattttgacgtttttggatgcc
ctggctcatatgaacatcattgacaactgtgatgtgacaggggtcatcgacacagcactg
ccatttggcatctgcatggcttttgccaacagctgcgtcaaccctttggtgtactgcttt
attgggaaccagttccaggagaagctccatcgcttgtttaagcgacgagtttaccagttc
aacagccaacgagagagctcttctttgaggaaagggagctgcttccgagacactgagata
gcagtgggcagggagagggagcccgagtccccgttgtga

DBGET integrated database retrieval system