KEGG   Gallus gallus (chicken): 396282
Entry
396282            CDS       T01006                                 

Gene name
BCL2
Definition
(RefSeq) apoptosis regulator Bcl-2
  KO
K02161  apoptosis regulator Bcl-2
Organism
gga  Gallus gallus (chicken)
Pathway
gga04115  p53 signaling pathway
gga04140  Autophagy - animal
gga04141  Protein processing in endoplasmic reticulum
gga04210  Apoptosis
gga04217  Necroptosis
gga04261  Adrenergic signaling in cardiomyocytes
gga04340  Hedgehog signaling pathway
gga04510  Focal adhesion
gga04621  NOD-like receptor signaling pathway
gga05132  Salmonella infection
gga05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    396282 (BCL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    396282 (BCL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    396282 (BCL2)
  09143 Cell growth and death
   04210 Apoptosis
    396282 (BCL2)
   04217 Necroptosis
    396282 (BCL2)
   04115 p53 signaling pathway
    396282 (BCL2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    396282 (BCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    396282 (BCL2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    396282 (BCL2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    396282 (BCL2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    396282 (BCL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gga01009]
    396282 (BCL2)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     396282 (BCL2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 396282
NCBI-ProteinID: NP_990670
CGNC: 9759
Ensembl: ENSGALG00000012885
UniProt: Q00709
Position
2
AA seq 233 aa
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDRPPVPPAPAPAAAPAAVAAAGASSH
HRPEPPGSAAASEVPPAEGLRPAPPGVHLALRQAGDEFSRRYQRDFAQMSGQLHLTPFTA
HGRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIATWMTEYLNRHLH
NWIQDNGGWDAFVELYGNSMRPLFDFSWISLKTILSLVLVGACITLGAYLGHK
NT seq 702 nt   +upstreamnt  +downstreamnt
atggctcaccccgggagaagaggctacgacaaccgcgagatagtgctgaagtacatccac
tataaactctcgcagcggggctacgactgggccgccggcgaggacaggccgcccgtgccc
ccggccccggctcccgctgctgctcccgctgcggtggctgctgctggagcctcctcccac
caccgccccgagccccccggctcggctgctgctagtgaggtgcccccggctgaggggctg
cgccccgcgcctcccggcgtccacctcgccctgcgccaggccggggacgagttctcgcgc
cgctaccagagggacttcgcccagatgtcgggccagctgcacctgacgcccttcacggcc
cacggccgcttcgtggccgtggtggaggagctcttccgtgatggggtcaactggggccgg
atcgtcgccttcttcgagttcggcggcgtgatgtgcgtcgagagcgtcaaccgggagatg
tcgccgctggtggacaacattgccacctggatgaccgagtacctgaaccggcacctgcac
aactggatccaggacaacggaggatgggatgcctttgtggaattgtacggcaacagtatg
aggcctttgttcgatttctcctggatctctctgaagaccatcctgagcctggttctggtg
ggagcttgcatcactcttggcgcttatcttggacataagtag

DBGET integrated database retrieval system