KEGG   Gallus gallus (chicken): 396378
Entry
396378            CDS       T01006                                 

Gene name
PLN
Definition
(RefSeq) cardiac phospholamban
  KO
K05852  phospholamban
Organism
gga  Gallus gallus (chicken)
Pathway
gga04020  Calcium signaling pathway
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    396378 (PLN)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    396378 (PLN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gga02000]
    396378 (PLN)
Transporters [BR:gga02000]
 Other transporters
  Pores ion channels [TC:1]
   396378 (PLN)
SSDB
Motif
Pfam: Phospholamban Sarcolipin Anoctamin
Other DBs
NCBI-GeneID: 396378
NCBI-ProteinID: NP_990741
CGNC: 11054
Ensembl: ENSGALG00000027583
UniProt: P26677
Position
3
AA seq 52 aa
MEKVQYITRSALRRASTLEVNPQARQRLQELFVNFCLILICLLLICIIVMLL
NT seq 159 nt   +upstreamnt  +downstreamnt
atggagaaggtccaatacataacccgctctgctctgaggagagcctcaactcttgaggtc
aacccacaagcacgccaaaggctccaggagctctttgtgaatttctgcctgatcttaatt
tgcctcttgctgatctgtatcattgtgatgctcctctga

DBGET integrated database retrieval system