KEGG   Gallus gallus (chicken): 416730
Entry
416730            CDS       T01006                                 

Gene name
PLCB4
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00562  Inositol phosphate metabolism
gga01100  Metabolic pathways
gga04020  Calcium signaling pathway
gga04070  Phosphatidylinositol signaling system
gga04261  Adrenergic signaling in cardiomyocytes
gga04270  Vascular smooth muscle contraction
gga04310  Wnt signaling pathway
gga04371  Apelin signaling pathway
gga04540  Gap junction
gga04621  NOD-like receptor signaling pathway
gga04912  GnRH signaling pathway
gga04916  Melanogenesis
Module
gga_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    416730 (PLCB4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    416730 (PLCB4)
   04371 Apelin signaling pathway
    416730 (PLCB4)
   04020 Calcium signaling pathway
    416730 (PLCB4)
   04070 Phosphatidylinositol signaling system
    416730 (PLCB4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    416730 (PLCB4)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    416730 (PLCB4)
  09152 Endocrine system
   04912 GnRH signaling pathway
    416730 (PLCB4)
   04916 Melanogenesis
    416730 (PLCB4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    416730 (PLCB4)
   04270 Vascular smooth muscle contraction
    416730 (PLCB4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    416730 (PLCB4)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     416730 (PLCB4)
Membrane trafficking [BR:gga04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    416730 (PLCB4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    416730 (PLCB4)
SSDB
Motif
Pfam: PI-PLC-X PH_14 PI-PLC-Y DUF1154 EF-hand_like C2 EF-hand_7 EF-hand_6
Other DBs
NCBI-GeneID: 416730
NCBI-ProteinID: NP_001186364
CGNC: 6764
Ensembl: ENSGALG00000008907
UniProt: R4GFB3
Position
3
AA seq 1194 aa
MAKPYEFNWQKPVPSFMQDGAVFDRYEEESFVFESSCLFQVDEFGFFLSWKSEGKEGQVL
ECSLINSVRFGAVPKDPKILTALEAVGKSENELEGRIVCVCSGIDLVNISFTFMVAENTE
VAKQWVEGLGSIIHNFRANNVSPMTCLKKHWMKLAFLTNTNGKIPVRSITRTFASGKTEK
VIFQALKELGLPSGKNDEIEPTAFTYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVD
QLVSFLNEHQRDPRLNEILFPFYDTKRAMQIIETYEPDEDLKSKGLISSDGFCRYLMSDE
NAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELD
CWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKM
SKYCEDLFGDLLLKQPLETHPLDPGKALPSPNDLKRKILIKNKRLKPEVEKKQLDALKKM
MEAGETAAPVNILEDDNEEEIESADQEEEAHPEYKFGSDLTVDDYSQKEAVAISVKKGLV
TVEDEQAWMASYKYVGATTNIHPYLSTMVNYAQPVKFQGFDVAEERNIHHNMSSFNESVG
LGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQL
NQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGT
YVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLAVLRIAVYDDNNK
LIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTVFCNIVLKTYVPDGFGDIVDALSDPKK
FLSITEKRADQMRAMGIETSDIADVPNDTSKNDRKGKANNAKANVTPQSSSELRPSTTAG
FGSGTDAKKGIDLIPQVKIEDLKQMKAYIKHLKKQQKELNALKKKHAKEHSAMQKLHCTQ
IDKIVAQYDKEKVSYEKMLEKAIKKKGGSNCVELKKETEIKIQALTSDHKSKVKEIVAQH
TKEWSEMINTHSAEEQEIRDLHLNQQCELLKKLLINAHEQQTQQLKFSHDRESKEMRANQ
AKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMKQSKEMDQLKKVQ
LEHLEVLEKQNEQLLKSCHAVSQTQGKGDAADGEAGSRDGSQASNSGLKPQHAN
NT seq 3585 nt   +upstreamnt  +downstreamnt
atggcaaaaccttatgaatttaactggcagaagccggttccctcttttatgcaagatgga
gctgtgtttgatagatatgaagaggaatcttttgtctttgaaagcagttgtctctttcaa
gtggatgaatttggcttttttctgagctggaaaagtgaaggaaaggaaggacaggtgtta
gagtgttccctgatcaacagtgttcgttttggagctgttccaaaggatcccaaaatacta
actgcacttgaggctgttggaaaatcagaaaatgagttggaaggacggatagtgtgtgtt
tgcagtggtatagatctggtgaacatcagcttcactttcatggtagcagaaaacacagaa
gtagccaagcaatgggtagaaggactgggatccatcatacataactttagagctaacaat
gtcagtccaatgacatgtctcaagaaacactggatgaagctggcctttctaacaaataca
aatgggaaaattccagttcggagcattaccagaacctttgcatcaggtaaaacagaaaaa
gtgatctttcaagcactcaaggagttaggtcttcccagtggaaagaatgatgaaattgag
cccacggcatttacttacgagaaattctatgagctcacccaaaagatatgtccccgaact
gacatagaggacctctttaagaagatcaatggagacaaaactgattatttaacggtagac
caattagtgagctttctaaatgaacatcaacgagatcctcggctcaatgaaattttattt
cccttttatgacacaaaaagagcaatgcagataattgagacatatgagccagatgaagac
ttgaagagtaaaggtctcatatcaagtgatggattttgcagatacttgatgtcagatgag
aatgccccagttttcctagaccgtttggaattataccaagaaatggaccacccgttggct
cactattttatcagttcttctcacaacacgtatttaacaggcaggcagtttggtggcaaa
tcttcggtggagatgtacagacaagtgctcttggctggatgcaggtgtgttgagctggac
tgttgggatggaaaaggtgaagaccaagaaccaataataacacatggaaaagcaatgtgc
acagatattcttttcaaggatgtaattcaagccattaaggaaacagcttttgttacatca
gagtatcccgtcattctttcatttgaaaatcattgcagcaaatatcagcagtacaagatg
tcaaaatactgtgaagatctttttggagatctcctgttgaagcagcctctagaaacacat
ccacttgatccaggtaaagccttgccttctcctaatgacctcaaaagaaagattctcata
aagaataaaaggttgaaacctgaagtagaaaaaaaacagctcgatgctctgaaaaagatg
atggaggctggtgaaaccgctgctcctgtgaatatcttagaggatgataatgaagaagaa
atagaaagtgctgaccaggaagaagaagctcatccagaatataaatttgggagtgacctt
actgtagatgattacagtcaaaaagaagctgttgctatcagcgtcaaaaagggcttagta
actgttgaagatgaacaggcatggatggcatcgtataaatatgtaggtgccacaaccaat
atacatccatatttatcaacaatggtcaactatgctcagcctgtaaaatttcaaggtttc
gacgtagcagaagaacgtaatattcatcataacatgtcctctttcaatgaatcagttgga
ctagggtatttgaagactcatgccattgagtttgtgaattataataaacgacaaatgagt
cggatatacccaaagggaggccgagtggattccagtaattacatgcctcaaattttctgg
aacgctggctgccagatggtctcactgaactatcagaccccagatttagcaatgcagttg
aatcaaggaaaatttgaatataatggatcatgtggctatctacttaaaccagatttcatg
cggcgcccggatagaacatttgaccctttctctgaaactcctgtagatggtgtaattgct
gcaacatgttctgtacaggtaatatctggtcagtttttatcagataaaaagattggtacg
tatgtagaagtggatatgtatggtttacccacggacacaatacgtaaagaatttagaacg
cgcatggtgatgaacaacggtctgaaccctgtttacaatgaagaatcatttgtatttcga
aaggttattctccctgatcttgctgtcctgagaatagcagtatatgatgacaataataag
ttgatcggtcagaggatcctgcctctagatggtctacaagcaggttacagacacatttca
cttcgaaatgagggcaacaaaccactctctcttccaacggttttctgcaacattgtgctc
aaaacatatgtgcctgatggttttggagatattgtagatgctttgtcagatccaaagaaa
tttttgtctattacagaaaaaagagcagaccaaatgagagctatgggtattgaaactagt
gatatagctgatgtaccaaatgacacttcaaaaaatgatagaaaaggaaaagctaataac
gccaaagcaaacgtgactcctcagagtagctctgagcttcgaccaagtaccacggcaggc
tttgggtctgggaccgatgctaagaaaggtatagacctaattcctcaagtgaagatagaa
gatttaaagcaaatgaaggcttacataaaacatttaaagaaacagcagaaagagctgaac
gccttaaagaagaagcatgcaaaggagcacagcgctatgcagaagttgcactgcacacaa
attgacaaaatagtggcacaatatgataaagaaaaggtatcatacgagaaaatgttagag
aaggcaatcaagaagaagggaggaagtaattgtgttgaattgaagaaagaaactgaaatt
aaaattcaggcactaacgtcagatcacaaatctaaggtcaaagagattgtggcacagcac
actaaagagtggtctgagatgatcaatacgcacagtgcagaagagcaagaaatccgtgat
ttacacttgaaccaacagtgtgaactactgaagaaactgctgattaatgctcatgaacaa
cagacccagcagctaaaattttcacatgacagggaaagcaaggagatgcgtgcaaaccag
gctaaaatatctatggagaacagcaaagccataagccaagataaatctatcaaaaacaaa
gcagaaagagagaggcgagtcagagaattgaacagcagcaacacaaaaaagttcctggaa
gagagaaaaaggcttgcaatgaaacagtcaaaggaaatggatcagttgaaaaaagttcag
cttgagcatttagaagtcttggaaaagcagaatgagcagcttttgaaatcctgtcatgca
gtgtctcaaacacaaggcaaaggagatgcagcagatggtgaagctggaagcagagatgga
tcgcaggccagcaacagtggtctaaagcctcaacatgcaaattga

KEGG   Gallus gallus (chicken): 423014
Entry
423014            CDS       T01006                                 

Gene name
PLCB2
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 isoform X2
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00562  Inositol phosphate metabolism
gga01100  Metabolic pathways
gga04020  Calcium signaling pathway
gga04070  Phosphatidylinositol signaling system
gga04261  Adrenergic signaling in cardiomyocytes
gga04270  Vascular smooth muscle contraction
gga04310  Wnt signaling pathway
gga04371  Apelin signaling pathway
gga04540  Gap junction
gga04621  NOD-like receptor signaling pathway
gga04912  GnRH signaling pathway
gga04916  Melanogenesis
Module
gga_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    423014 (PLCB2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    423014 (PLCB2)
   04371 Apelin signaling pathway
    423014 (PLCB2)
   04020 Calcium signaling pathway
    423014 (PLCB2)
   04070 Phosphatidylinositol signaling system
    423014 (PLCB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    423014 (PLCB2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    423014 (PLCB2)
  09152 Endocrine system
   04912 GnRH signaling pathway
    423014 (PLCB2)
   04916 Melanogenesis
    423014 (PLCB2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    423014 (PLCB2)
   04270 Vascular smooth muscle contraction
    423014 (PLCB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    423014 (PLCB2)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     423014 (PLCB2)
Membrane trafficking [BR:gga04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    423014 (PLCB2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    423014 (PLCB2)
SSDB
Motif
Pfam: PLC-beta_C PI-PLC-X PI-PLC-Y PH_14 EF-hand_like C2 DUF1154 MMACHC
Other DBs
NCBI-GeneID: 423014
NCBI-ProteinID: XP_015141761
CGNC: 3557
Ensembl: ENSGALG00000042105
Position
5
AA seq 1142 aa
MEMYVILKCQKLREVFNLDYPHSTFLLKTLTVVSGPDMVDLTFHNFVSYKENVGKSWAED
IMAIVQNPLTYNASRYTFLEKILVKLKMQLNAEGKIPVRNIFQMFPADRKRVEAALSACH
LPKGKNDAINPEDFPETVYKTFLMNLCPRPEIDEIFTSHHFKAKPYMTKEHLAKFINKKQ
RDSRLNDILFPPAKPEQVQSLIEKYEPSVINIQRGQLSPEGMVWFLCGPENNVIALDKLV
LYQDMTQPLSHYFINSSHNTYLTAGQFSGISSPEMYRQTLLAGCRCVELDCWKGRPPDEE
PIITHGFTMTTEILFKDAIEAIAESAFKTSLYPVILSFENHVDSPKQQAKMAEYCRTIFG
DMLLTEPLEKYPLKPGVPLPSPKDLLGKILIKNKKKQSVSEKRQNSMKKGKNVEPEIIEQ
PAFMDAEDTVWAGDVAEEEPEEEDDQLGNLDEEEIKKMQSDEGTAGLEVTAYEEMSSLVN
YIQPIKFDSFEVSAQKNRSYVISSFTELKAYDLLTKFPMQFVEYNKRQMSRIYPKGTRMD
SSNYMPQMFWNVGCQMVALNFQTMDVPMQQNMALFEFNGQCGYLLKHEFMRRPDKQFDPF
SVDRIDVVVASTLSVTILSGQFLSDRSVKTYVEVELFGLPRDTKRKYRTKLTSTANSINP
VWKEEPFVFEKIMMPELASLKIVAFEEGGKFIGHRVIPIIAVHSGYHHVCLRSESNMPLT
MPSLFVYLEVKDYVPDAWADLTIALSNPIKFFSLQEKRSVNLKDGSEVERPDMQRNFSFP
ENNGIPESTRKFSTPFANGPAGAAALVKDGNMKEVTQLAEPQTASLAELQQMKLFLKLLK
KQEKELKELERKGSKRREELLQKYSLLFLEPVCPGGKKRSIHSRKTQKKRSLTTGDVGTC
VHPVEMAESLDSRVLELKERLEMELIHLGEEYHDGIRRRKEQHATEQTAKITELAREKQT
AELKALKESSESNIKDVKKKLEAKRLERIQVMMRSTNDKAAQERLKKEINNSHIQEVVQT
IKLLTEKTARYQQKLEEKQAENLRAIQEKEGQLQQEAAAEYEEKLRGLTVEVQEMVKNCV
KEVFPDGPEIQKEAVLSIPVEEQSSTKQLEEKIPGAEVSRLTAATAEPPGAETDITIEES
IL
NT seq 3429 nt   +upstreamnt  +downstreamnt
atggaaatgtatgtgattttaaagtgccagaagctccgcgaggtctttaacttggattac
cctcacagcacctttctgctgaaaactctgaccgttgtgtctggccctgacatggtggac
ctcactttccataacttcgtgtcctacaaggagaacgttggcaagagctgggctgaggat
atcatggccattgttcagaatcccctcacatacaacgcttctcggtacaccttcctagaa
aaaatcctggtgaagctgaagatgcagctgaacgcagagggaaagattcctgtcaggaat
atttttcagatgtttcctgcagacaggaagagggtggaagcagcattaagcgcttgtcat
cttccaaaaggcaagaatgatgccatcaacccagaggacttccctgagactgtgtataaa
actttcctcatgaatctgtgcccacggcctgagattgatgagatatttacttcacaccat
ttcaaagcaaaaccctacatgaccaaagaacacttggcaaagtttatcaacaagaagcag
cgagactctcgcctcaacgacatccttttcccaccagcaaaacctgagcaggtgcagagc
ctgatagagaaatatgagcccagtgtcattaacatccagagagggcagttgtctccagag
ggaatggtctggtttctctgcggccctgagaacaacgtgatagcactggacaaattggtg
ctgtatcaggacatgacacagcccctctcacactacttcatcaattcgtcccacaacact
tatttaacagctggccagttttctggtatctcctctcccgaaatgtaccgtcagacgctg
ctggccgggtgtcgctgtgtggagctggattgctggaagggccgtcccccagatgaggag
cccatcatcactcacgggttcaccatgacaactgaaatcctcttcaaggatgccattgag
gccattgcagaaagtgctttcaaaacatccctttaccctgtcatcctctcctttgagaac
catgtggactcgcccaagcagcaggcaaagatggctgagtactgccgaaccatatttgga
gatatgctgctgacagagcctctggagaaatacccactgaagccaggagttcctctgccg
agtcctaaggatctcttagggaaaatcttaattaagaacaaaaagaaacagtctgtgtct
gagaagaggcagaattctatgaagaaggggaagaatgtggaaccagaaatcatcgagcag
ccagcttttatggatgctgaagatactgtctgggcaggagatgtggctgaagaggaacca
gaggaagaggacgatcagctaggaaacctggatgaagaggaaataaaaaagatgcagtca
gatgagggcactgctggtttggaagtgacagcatatgaggaaatgtccagcctcgttaat
tacatacagcccatcaagtttgactcctttgaagtctctgcccagaagaaccggagttac
gtcatctcttccttcaccgagctgaaggcttacgatctgctgaccaagttccctatgcag
tttgtggaatacaacaagcgccagatgagccggatttaccccaaaggcacccggatggac
tcctccaattacatgccccagatgttctggaacgttggctgtcagatggtggcactgaac
ttccagaccatggatgtccccatgcagcagaacatggctctgtttgagttcaatggccag
tgtggctatctgctcaagcatgaattcatgcggcgcccagacaagcagtttgaccctttc
tccgtggaccgcattgatgtggtggtggcaagcaccctgtctgtcacgatactttctggt
caattcctctcagaccgcagtgtgaagacgtatgtggaagtggagctgtttgggctgcca
agggacacgaagcgcaaatacagaaccaaactgacctccactgccaattccatcaatcct
gtttggaaagaagaaccttttgtttttgaaaagatcatgatgcctgagctggcatcgctc
aaaattgtggcttttgaggaaggagggaagttcattggtcatcgtgtcattcccattatt
gcagtacactcaggctatcaccatgtttgtctccgcagtgaaagcaatatgccactcacc
atgccctctctatttgtgtacctggaagtaaaggattacgtccctgatgcctgggcagat
ctgactattgctctctccaacccaattaagttcttcagtctgcaagaaaagagatcagtt
aatctaaaagatggctcggaggtggagaggcctgacatgcaaaggaacttctcattccct
gaaaataatgggataccagagtccaccaggaaattcagcaccccttttgcaaatgggcct
gcaggagcagcagctctggtcaaggatggaaacatgaaggaagtgacacagcttgcagag
cctcagacagccagccttgcagagctgcagcagatgaagctgttcctgaagctgctgaag
aagcaggagaaagagctgaaggagctggagcggaaaggaagtaaacggagagaagagttg
ctgcagaaatattctcttctctttttggagcctgtctgccccggaggcaagaaaagatcc
atacactccagaaaaacccagaagaagaggagtttgacgacaggtgatgttggtacctgc
gtgcatcctgtggaaatggcagaaagccttgatagccgagttttggagctgaaagagagg
ctggagatggagcttatccacctgggggaagaataccatgatgggattcgaagaaggaaa
gagcagcatgccacagagcaaacggccaagataacagagctagccagagagaagcagaca
gctgagctgaaggcactgaaggagtcatcagaaagcaacattaaagatgttaagaagaag
ctggaggcaaaacgattagaacgaatccaagtcatgatgaggagtactaatgacaaggct
gctcaggagaggttgaagaaagaaattaataactctcacatccaggaagtggtccaaaca
atcaaactgctgacagaaaagacagccaggtatcagcagaagctggaagagaagcaggca
gagaatctgagagcaatccaagagaaagaaggccagctccagcaggaggcagcggcagaa
tacgaggagaaattgagaggtctgacagtggaggtgcaggagatggtgaagaactgtgtg
aaagaagtctttcctgatgggccggagattcagaaggaagcagttctgagcattcccgtg
gaagaacaaagctctacaaagcaactggaagagaagatccctggggcagaggtgtcaagg
ctgacagcagctacggctgagcctccaggagccgaaacagacatcaccattgaggaaagc
atactgtga

KEGG   Gallus gallus (chicken): 427687
Entry
427687            CDS       T01006                                 

Gene name
PLCB1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00562  Inositol phosphate metabolism
gga01100  Metabolic pathways
gga04020  Calcium signaling pathway
gga04070  Phosphatidylinositol signaling system
gga04261  Adrenergic signaling in cardiomyocytes
gga04270  Vascular smooth muscle contraction
gga04310  Wnt signaling pathway
gga04371  Apelin signaling pathway
gga04540  Gap junction
gga04621  NOD-like receptor signaling pathway
gga04912  GnRH signaling pathway
gga04916  Melanogenesis
Module
gga_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    427687 (PLCB1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    427687 (PLCB1)
   04371 Apelin signaling pathway
    427687 (PLCB1)
   04020 Calcium signaling pathway
    427687 (PLCB1)
   04070 Phosphatidylinositol signaling system
    427687 (PLCB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    427687 (PLCB1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    427687 (PLCB1)
  09152 Endocrine system
   04912 GnRH signaling pathway
    427687 (PLCB1)
   04916 Melanogenesis
    427687 (PLCB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    427687 (PLCB1)
   04270 Vascular smooth muscle contraction
    427687 (PLCB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    427687 (PLCB1)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     427687 (PLCB1)
Membrane trafficking [BR:gga04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    427687 (PLCB1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    427687 (PLCB1)
SSDB
Motif
Pfam: PI-PLC-X PH_14 PLC-beta_C PI-PLC-Y EF-hand_like C2 DUF1154
Other DBs
NCBI-GeneID: 427687
NCBI-ProteinID: XP_025005026
CGNC: 6740
Ensembl: ENSGALG00000008875
Position
3
AA seq 1219 aa
MAGAQPGVHALQLKPVCVSDTLKKGIKFVKWDDDSTVVTPIILRTDPQGFFFYWTDQNKE
TELLDISLVKDARCGKHARAPKDPKLRELLDAGNVGSRLENRMITVVYGPDLVNISYLNL
VAFQEDIAKEWSDEVFSLATNLLAQNMSRDAFLEKAYTKLKLQVTPEGRIPLKNIYRLFS
ADRKRVETALEACNLPSSRNDSIPQDDFTPDVYRVFLNNLCPRPEIDHIFSEFGAKSKPY
LTVDQMMEFINLKQRDPRLNEILYPPLKQEQVQQLIEKYEPNSNLAKKGQISVDGFMRYL
SGEENGVVPPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRC
VELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPK
QQAKMAEYCRLIFGDALLMDPLEKYPLEPGVPLPSPMDLMYKILVKNKKKSHKSADGSAK
KKLSEQASNTCSDTSSMFEPSSPGAGEAEIESDDDDDYDDDCKKSSMDEGTAGSEAMATE
EMSNLVNYIQPVKFESFEVSKKRNKSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIY
PKGTRVDSSNYMPQVFWNAGCQMVALNFQTVDLSMQINMGMYEYNGKSGYRLKPEFMRRP
DKHFDPFTESIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDMFGLPVDTRRKALKTKTS
QGNAVNPVWEEETIVFKKVVLPTLACLRLAVYEEGGKFIGHRILPVSAIRPGYHYICLRN
ERNQPLTLPALFVYIEVKDYVPDTFADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEV
KKEVDHGDAPSEANSEPRPTPAENGVNHTASLTSKPTTQVVHSQPTPGLVKAPAKTEDLI
QSVLTEVEAQTIEELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTDLIKEHTAKYNEIQND
YLRRRAVLEKTAKRDSKKRSETGSPDHGSSTIEQELASLDSEMTQKLVELKEKQQQQLLN
LRQEQYYSEKYQKREHIKLLIQKLTDVAEECQNSQLKKLKETCEKEKKELKKKMDKKRQE
KITEAKSKDKNQMEEEKTEMIRSYIQEVVQYIKRLEDAQSKRQEKLIEKHKEIRQQILDE
KPKLQVELDQEYQDKFKRLPLEILEFVQEAMKGKISEDGDHSSAPSSLASDSGKSNHKPL
QSEEELEEDNSEKVFDTTF
NT seq 3660 nt   +upstreamnt  +downstreamnt
atggccggggcacagccaggggtgcacgctttgcagctcaagcccgtctgcgtctccgac
acgctgaagaaaggcatcaaattcgtcaagtgggacgatgactcaactgttgtgactcca
attatactcagaacggatccacagggatttttcttctactggacagatcaaaacaaggag
acagagctgctcgatatcagtcttgtcaaagatgccagatgtggaaaacatgccagagct
cccaaggatccaaagctgcgtgagctgctggatgctgggaacgttggaagtcggcttgaa
aatcgaatgataactgttgtctatggaccagacctggtcaatatatcgtacttgaacttg
gtggcgtttcaagaggatatagcgaaggaatggtcagatgaagtgttcagtttggcaaca
aatttgttggcacagaacatgtcaagggacgcatttctggaaaaagcctacacaaaactt
aaactacaggtgactccagaaggacgcattcctctgaagaacatataccgcttgttttct
gctgacagaaaacgtgtagagacagcattagaagcttgtaatcttccatcttccaggaat
gattcaatccctcaagatgacttcacgcccgacgtgtacagagtgttcttaaacaacctc
tgccctcgacctgaaatcgaccacatcttttccgagtttggtgccaagagtaaaccatac
cttactgttgatcagatgatggaatttataaatcttaagcaacgtgatccacgattaaat
gaaatcctttatccaccattaaaacaggaacaagttcaacaactgattgagaaatatgaa
cccaacagtaacctagcgaagaaaggacagatatcagtggatggatttatgcgatatctg
agtggagaagaaaatggcgttgttccacctgagaaactggatttaaatgaagatatgtct
caaccactgtcacactatttcatcaattcctcacacaacacctacctcacagctggacag
ctggccgggaactcttcggtggagatgtatcggcaagtgcttctgtcaggctgccgctgt
gtggagctggactgctggaaagggcgaacagctgaagaagagccggtcattacgcacggc
ttcactatgacaactgaaatatctttcaaggaagtaatagaagctattgctgagtgtgca
tttaagacatcgccctttccaatcctcctttcctttgaaaatcatgtggattcccctaag
caacaggcaaaaatggcagagtactgcagattaatatttggagatgcattgcttatggat
ccactggagaagtacccgcttgaacctggggttcctcttccaagccctatggatttaatg
tacaaaattctggtgaaaaataaaaagaagtcacataagtctgcagatggaagtgccaag
aagaagctctcagagcaagcttccaacacgtgcagtgatacatctagtatgtttgagcct
tcctccccaggagcaggagaagcagagattgagagtgatgatgatgatgactacgatgat
gattgtaaaaagtcgtcgatggatgaaggtactgctggaagtgaggctatggccacagaa
gagatgtctaacctggtgaactacattcagcctgtgaaatttgagtcatttgaggtatca
aaaaaacgcaacaaaagttttgaaatgtcttcctttgtggaaaccaaagggcttgagcaa
cttaccaagtctcctgtggaatttgtggaatacaacaaaatgcagctaagccgaatttac
ccaaaaggaacacgtgtagattcttcaaactacatgccacaagtcttttggaatgctggc
tgccaaatggttgctctcaacttccaaactgtagatttgtctatgcaaataaacatggga
atgtatgagtacaatggcaaaagtggatacaggttaaagccagaattcatgagaagacca
gacaaacactttgatccatttactgagagcattgtggatggaatcgtagctaacaccttg
tctgtgaagattatttcaggccagtttctttctgataaaaaagttggtacctatgtagaa
gttgacatgtttggcctgcctgtggatacaagaagaaaagctttaaagaccaagacctcg
caaggcaatgcagttaatcctgtctgggaagaggaaactatagtgttcaagaaggttgtt
ttacctaccctggcatgtttgaggctagcagtgtatgaggaaggagggaaatttattggt
catcggatattaccagtctcagcaattcgaccaggctaccactacatctgtttgaggaat
gagaggaaccaacctttgacactgccagctctctttgtgtacattgaggtcaaagactat
gtgcctgatactttcgcagatgtgatcgaggccttatccaatccaatcagatatgtaaac
ttgatggagcagagagctaagcaactggcagcactgactctggaagatgaagaagaggta
aagaaagaggtggaccacggagatgcaccatctgaagctaacagtgaacctaggccaaca
ccagcagaaaatggagtaaatcacactgcctctcttacatcgaaaccaacaactcaggtt
gtccatagccaaccaacaccaggtttggtgaaagcacccgcgaagaccgaagatcttatt
cagagtgtcctcacagaagtggaagcgcagactattgaagagctaaaacaacagaagtca
tttgttaagcttcagaagaagcactacaaagaaatgaaggaccttgttaaaaggcaccac
aagaaaaccactgatcttatcaaagagcacactgcaaagtataatgaaatccaaaatgac
tatctgcgacgaagagcagttttagaaaaaacagcaaaaagagacagtaagaaaagatct
gaaacaggcagcccagaccatggttcatcaactattgaacaagaactggcttcccttgac
tctgaaatgacccagaagctagttgagttgaaggaaaagcaacagcagcagctgctaaac
ctccgacaggagcagtattacagtgaaaagtaccagaagcgagagcacattaagctgctt
attcagaagttgacagatgtagcagaggaatgtcagaacagccagctaaagaaactgaaa
gaaacgtgtgaaaaagaaaagaaagaattgaagaaaaaaatggacaagaagaggcaggag
aagatcacagaagcaaaatccaaggataaaaatcaaatggaagaagagaagactgaaatg
attcgatcgtatatccaggaggtggtgcaatacataaaaaggctagaggatgctcagagt
aaaagacaggagaaactgatagaaaaacacaaggagatccgtcagcaaatactggatgaa
aagcccaagttgcaggtggaacttgatcaggaatatcaagacaaattcaaaagactgcct
ttggaaattctggagtttgtacaggaagccatgaaagggaaaatcagtgaagatggagac
cacagttctgccccctcttctctggcatctgacagtgggaaatcaaatcataaacctctg
caaagtgaagaggaactggaagaagataattcagaaaaagtgtttgatactactttttaa

DBGET integrated database retrieval system