KEGG   Gallus gallus (chicken): 417319
Entry
417319            CDS       T01006                                 

Gene name
PIK3R5
Definition
(RefSeq) phosphoinositide 3-kinase regulatory subunit 5
  KO
K21290  phosphoinositide-3-kinase regulatory subunit 5/6
Organism
gga  Gallus gallus (chicken)
Pathway
gga04261  Adrenergic signaling in cardiomyocytes
gga04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    417319 (PIK3R5)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    417319 (PIK3R5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    417319 (PIK3R5)
Membrane trafficking [BR:gga04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    417319 (PIK3R5)
SSDB
Motif
Pfam: PI3K_1B_p101
Other DBs
NCBI-GeneID: 417319
NCBI-ProteinID: NP_001025868
CGNC: 14629
Ensembl: ENSGALG00000026167
UniProt: Q5ZIB8
Position
18
AA seq 881 aa
MQHTTCTEDRIYHALERCLHGLSRDAVSSRWAAGLCLNCWSLQELVSRDAGNYLILVEKI
LGKAREVQEKCDYDLVMPLALLFYYAVLYAPHIPPDSELLLKAASIYHSFLTWPVPYCDV
FRELLTFISDELKAPGISFQRLVRTEQGLPVKNYQSSTVTVLLLNRSEVQSEFLSIAEKL
SSTEPPRHATLVLLLEHLYQVTFGTRCDLGSLHHLLKAKTLEELSEIYTSAAEAQEIAAA
SSDPVLARERLQSALRDIAGAAALPTIAGDAQPRRLQPIPIPTSRCYTYSWDQDNFDVLN
DVLSKECSVVEPVASENEEDEEEEEEDVETDGCSPERDSLLSPISSISKDSVYSALSEDG
PKHSCVSLFSSSKDSISELTVVSKKSLRSFVSSLKDCMDSGYAEDSDESSLDTLGRPELK
VEKTHHKYRHTLTNKIYKLFKSKSQLVLRRDLKDCVDTGSLPLRRAESLCHPQAKPRIPA
RSRRAHSLPQHGLGQKLQTPQTPQLLSLPRRPFLSYDEDAKVATMRVVVFGSDRISGKVA
RAYSNLRLKESTCPTLTRYFKLQFFYVPVKRSCLLPAALLMHPPPSPSDLQLRALAQAEP
TLAGAESSTNDISHYIGMLDPWYERNVLGLMNLPMDVLCQSAKPEAEPQEDSREQLPILA
DMILYYCRFATRPVLLQLYQTELTFIGGEKMTEVFIHSLELGHSAATRAIKASGPGSKRL
GIDGDREAIPLTLQIAYSKTAISGRSQWNDVEKVCTSVNLSKACKKYEELASKTECLNLT
MTEVVKRQNSKSKKSFNQLSVSQIKVDKVQIIGVQSSFAVCLDQDEQKILQSVTRCEISV
CYRPRDSDPLALRRSSLTPQDPSEFHSLLCLPISTFSGALP
NT seq 2646 nt   +upstreamnt  +downstreamnt
atgcagcacaccacgtgcacagaggacaggatctatcatgcactggagagatgtctgcac
gggcttagcagagatgctgtctccagcagatgggctgcagggctgtgcctgaactgctgg
agcctgcaggagctggtgagcagggatgcaggtaactacctcatcctggtggagaaaatc
ctcggcaaggccagggaggtgcaggagaagtgtgactacgacctggtgatgcccctggcc
ctgcttttctactacgcggtcctctatgctccccacatcccaccagactccgagctgctc
ctgaaagctgccagcatctaccacagcttcctcacctggcccgtgccctactgcgacgtc
ttccgtgagctgctcaccttcatcagtgatgagctcaaggcgccagggatttccttccag
aggttggtgaggacggagcaggggctgcctgtgaagaactaccagagctccactgtgacg
gtgctgctgctgaaccgctccgaggtgcagagtgagttcctctccatcgcagagaagctg
agcagcactgagcccccccggcacgccacgctcgtcctgctgctggagcacctctaccag
gtcaccttcggcacccgctgcgacctgggcagcctgcaccacctcctgaaggccaagaca
ctggaagagctctctgagatctacaccagcgctgctgaagcgcaggagatcgcagccgcc
agcagtgaccctgtgttggcccgggagcggctgcagagcgctctgcgggacattgccggg
gcagcagcacttcctaccattgcaggagatgcgcagccccgcaggctgcagcccatcccc
atccctacttcgcgctgctacacctacagctgggaccaggataactttgatgtcctcaat
gatgtcctcagcaaggagtgcagtgttgttgagcctgtggcctcagagaatgaggaggac
gaggaagaggaggaggaggatgtggaaacagacggctgttccccagagagggactcgctg
ctgtcccccatctcctccatttccaaggactccgtgtactcagcgctgtcagaggatgga
cccaagcactcctgcgtgtccctcttcagcagctccaaggactccatctcagagctgacg
gtggtctccaagaagtccttgaggtcttttgtctccagcctgaaggactgcatggacagc
gggtacgcagaggacagcgacgagagctccctggacacgcttgggcggccggagctgaag
gtggagaagacccaccacaaatacagacacacgctgaccaacaagatctacaagctcttc
aagagcaaaagccagctggtcctgaggagagacctgaaggactgtgtggatacaggctcg
ctcccactgcgccgtgctgagagcctgtgccacccccaggccaagccccgcatcccggca
cgctcccggcgcgctcactcattgccacagcacgggctgggccagaagctgcagaccccg
cagaccccgcagctgctcagcctgccccgccggcccttcctcagctacgacgaggatgcc
aaagtggccaccatgcgcgtggtggtcttcggctccgaccgcatctcagggaaagtagcc
cgagcctacagcaacctgaggctgaaggagagcacctgccctacactgacaaggtacttc
aagctgcagtttttctacgtccccgtgaagaggagctgcctgctgccagcagccctgctg
atgcatcctcctccatccccaagcgacctgcagctccgcgccttggcacaggcggagccc
accttggctggggcggagagcagcaccaatgacatctcccactacatcggcatgttggac
ccatggtacgagcggaacgttctggggctgatgaacctgcccatggatgtcctgtgtcag
tctgccaagcctgaggctgagccccaggaggactcccgggagcagctgcccatcctggcc
gacatgatcctctactactgccgctttgccacacgccccgtcctgctgcagctctaccag
accgagctcaccttcatagggggggagaagatgaccgaagtcttcatccactccctggag
ctgggccactcggcggccacgcgggccatcaaggcgtcaggtccgggcagcaaaaggctg
ggcatagatggagacagagaagcaatcccactaacactacagatcgcctacagcaagaca
gccatcagtggaaggagtcagtggaacgatgttgagaaggtctgcacatctgttaacctc
agcaaagcctgcaagaagtacgaagagctggcctcgaagacagagtgtctcaacttgacc
atgacagaggtggttaaaaggcaaaactccaaatccaaaaaaagtttcaatcagctcagt
gtgtcccagatcaaggtagacaaagtccagattattggtgtccagtcctcctttgccgtg
tgcctggatcaggatgagcagaagatcctgcagagtgtaaccaggtgtgagatctccgtg
tgctacagacccagggacagcgatccccttgcactgagaaggtcctctttgactccccag
gacccctccgagtttcattctctcctgtgtttacccatttccaccttcagtggagcactg
ccatag

KEGG   Gallus gallus (chicken): 417706
Entry
417706            CDS       T01006                                 

Gene name
PIK3CG
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
  KO
K21289  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma [EC:2.7.1.153]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00562  Inositol phosphate metabolism
gga01100  Metabolic pathways
gga04261  Adrenergic signaling in cardiomyocytes
gga04371  Apelin signaling pathway
gga05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    417706 (PIK3CG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    417706 (PIK3CG)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    417706 (PIK3CG)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    417706 (PIK3CG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    417706 (PIK3CG)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     417706 (PIK3CG)
Membrane trafficking [BR:gga04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    417706 (PIK3CG)
SSDB
Motif
Pfam: PIK3CG_ABD PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 DUF4135
Other DBs
NCBI-GeneID: 417706
NCBI-ProteinID: NP_001186467
CGNC: 6119
Ensembl: ENSGALG00000008081
UniProt: E1C093
Position
1
AA seq 1106 aa
MELGDYEQPVVMREENKRRRRRMKPHCTSSNLSSMELISIEFILPTSNKHTKVPEMMLLE
IAGNCTVEQMKAQIWMRAIEMSQTTDFYHTFTPDQFVLQYQKKGQWYEIYDKHQLLQTLD
CILYWKVLQKKVGKIYVVQKQKPSEEVQEFQRQLNDLIGYDVTDVSNVHDDELEFTRRRL
VTPRMIEVACRDPKLYAMHPWTTSKPLPEYLFKKITNNNIFIIIHRGTTSQKIKVSIDDT
PDMILHSFFTKMAKKKSLMDIPEDHSELDFVLRICGRDEYITGDTPIKDFHWIRQCLKNG
EEIHLVLDNPPDPSEDEVQKEEWPLVDDCTGVTGYHEQLTIDGKDHERVFTISLWDCNRK
FRVKIIGIDIPVLPRNTDLTVFVEANIQHGQQLLSQRRTSSKPFTEEVLWNIWLEFDIKI
KDLPKGALLNLQIYCGKAQGLSTKTNLQSHESPNSDSKCKTQLLYYVNLLLIDHRFLLRS
GEYVLHMWKIPGKGEEQGSINADKLTSATNPDKENSMAISIVLDKYCHPIALPKHRITSD
SQGDRTRAEMPNQLRKQLEEIIATDPLNPLSPEDKELLWHFRYESIKHPKAYPKLLSSVK
WGQQEIVAKTYQLLAKKEVWDQSTLDVGLTMQLLDCNFSDENVRAMAVQKLESLEDDDVL
HYLLQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSMHYQQRFAVIL
EAYLRGCGKAMLHDFMKQVQVIELLHKVTMEIKSVSAEKYDVTSQVIAQLRQKLEKLQGS
KLPESFRVPYDPGLRAGPLVIEKCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDD
LRQDMLILQILRIMESIWEAESLDLCLLPYGCISTGNKIGMIEIVKDATTIAKIQQSTVG
NTGAFKDEILNQWLKDRCVIEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMITET
GNLFHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSLHFHKFQDVCVKAY
LALRHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKSEEDAKKHFLDQIEVCRD
KGWTVQFNWFLHLVLGIKQGVEKHSA
NT seq 3321 nt   +upstreamnt  +downstreamnt
atggagttgggtgactatgaacagcccgttgttatgagagaagaaaacaaacgaaggaga
agaagaatgaaacctcattgtacatcgagtaatttgtcttcaatggaactgatatccatt
gagttcattttacctacaagcaataagcatactaaagtaccggaaatgatgttactcgaa
atagctggaaactgtactgttgagcaaatgaaagcacaaatttggatgcgtgcaatagag
atgagtcaaaccacagacttctaccacacgttcaccccagatcagtttgttcttcagtat
cagaagaaggggcaatggtatgaaatttatgataaacatcaactattacagacattagac
tgcatactgtactggaaagtgttacagaagaaagtgggcaagatatacgtagtccagaaa
caaaagccatcagaagaagttcaggaatttcagcggcagcttaatgatttaattggttat
gatgttactgatgtaagcaatgtgcacgatgatgagctagaatttacccgacgcagatta
gtcactccacgaatgatagaggtagcctgtagagatcctaaattgtatgcaatgcaccca
tggacaacatctaagccactcccagaatatttgtttaaaaagatcactaataataacatt
tttataatcatacatagaggaacaacgagccagaaaattaaagtgtcaatagatgacact
ccagatatgattctccatagctttttcacaaaaatggcaaagaaaaaatctttgatggat
attcctgaagatcatagcgaactggattttgttcttaggatttgtggcagagatgagtac
attactggagacacacccatcaaggattttcactggataagacagtgccttaagaatggg
gaagaaatccaccttgtgttagacaacccccctgacccaagtgaggatgaggtacagaag
gaagagtggccgttggtggatgactgtaccggagttacaggatatcacgaacaattgaca
atagatggaaaagatcatgagagagtcttcactatctctttgtgggattgtaataggaaa
ttcagggtgaaaataattggtatcgacatcccagttttaccaagaaatactgatcttact
gtatttgtggaggctaacattcaacatgggcaacagctcctttcacaaaggaggacttcc
tcaaagccttttactgaagaggttctgtggaatatttggttggagtttgatatcaaaatc
aaggatttgcctaaaggagcactcttgaatcttcagatatattgtggtaaagcacaggga
ttgtccacaaagacaaaccttcagtcacatgaatcccccaactctgattcaaaatgcaaa
actcaacttctctattacgtgaatcttttactgatagatcaccgtttcctgttgcgaagt
ggggagtatgttctccacatgtggaaaatcccaggcaaaggggaagaacaaggaagtatc
aatgcagacaaactcacctcagcaactaatccggataaagaaaactcgatggctatctct
attgtgctggacaaatattgtcacccgattgccttgcccaagcacaggataacatctgac
tctcagggggacaggacacgagctgaaatgcccaaccagcttcgcaagcaacttgaagag
atcatagcaactgacccacttaatccactttctcctgaggacaaagaactgttgtggcac
tttaggtatgaaagcataaagcaccccaaggcataccctaagctgcttagctctgtcaaa
tggggacaacaagaaatagtggccaaaacataccagttgctagctaaaaaggaggtgtgg
gatcaaagcactttagatgttggactcacaatgcagcttctggactgtaacttttctgat
gaaaatgtacgagcaatggcagttcaaaaactggaaagtttagaagatgatgatgttctt
cattaccttttgcaacttgtgcaggctgtgaaatttgagccctatcatgacagcgcatta
gccagatttctgctgaaacggggtttaagaaacaaaagaatcggtcacttcttgttttgg
tttttaagaagtgagattgcccagtctatgcactaccaacagaggttcgctgtgatccta
gaagcctatcttcggggctgtggaaaagcaatgctgcatgatttcatgaaacaggttcaa
gtcattgaattgctgcataaagtcacaatggagataaaatcagtttctgcagaaaaatac
gatgtcacttctcaagttattgcacagcttagacaaaaacttgaaaaactacagggcagc
aaacttccagaaagttttagagtcccgtatgaccccgggctaagagcaggacccctggtg
atagaaaaatgtaaagtaatggcatccaagaagaagcccctttggcttgagtttaaatgt
gcagatccaactgctctatcaaatgaaaccataggcatcatctttaaacacggagatgac
ctccgtcaggacatgcttattttacagattcttcgaataatggaatccatttgggaagca
gaatccttggacctctgtttgctaccgtatggctgtatttctacagggaacaaaatagga
atgattgaaattgtgaaagatgctacaacgattgccaaaattcagcagagtacagttggc
aacactggtgcatttaaggatgaaatactgaaccagtggctcaaggacagatgtgtcatt
gaggagaagtttcaggcagctgtggaaaggtttgtttattcctgtgctggctactgtgtg
gcaacctttgttcttgggataggagacagacacaatgataacattatgatcacagaaaca
ggtaacctttttcatattgattttggccatattcttgggaattataaaagcttccttgga
attaataaggaaagagttccttttgtgctgactccggattttctgtttgtcatggggacc
tctggaaagaagacaagtctccatttccacaaatttcaggatgtgtgtgtgaaggcttat
ttagctctccgacatcacaccaacctgctcatcatcctgttctccatgatgctaatgact
ggaatgccccagttaaccagcaaagaggatattgaatatatccgggacgcgctgacagta
gggaaaagcgaagaagatgctaaaaagcatttccttgatcagatcgaggtttgcagagat
aagggctggactgtgcaatttaactggttcttacatcttgtgcttggaatcaagcaagga
gtagaaaagcattctgcttaa

KEGG   Gallus gallus (chicken): 769202
Entry
769202            CDS       T01006                                 

Gene name
PIK3R6
Definition
(RefSeq) phosphoinositide 3-kinase regulatory subunit 6 isoform X2
  KO
K21290  phosphoinositide-3-kinase regulatory subunit 5/6
Organism
gga  Gallus gallus (chicken)
Pathway
gga04261  Adrenergic signaling in cardiomyocytes
gga04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    769202 (PIK3R6)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    769202 (PIK3R6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    769202 (PIK3R6)
Membrane trafficking [BR:gga04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    769202 (PIK3R6)
SSDB
Motif
Pfam: PI3K_1B_p101
Other DBs
NCBI-GeneID: 769202
NCBI-ProteinID: XP_001232431
CGNC: 837
Ensembl: ENSGALG00000042351
UniProt: A0A1D5P757
Position
18
AA seq 762 aa
MLCCNPGPAMESAEVESDILRRVRTLLRELDGHHPACQRDRGMLRWTLHKKIDQNPSNSP
ILVRILVKELERAERGDYRHYIIPLLHTLMYALIKAPCISDELCSRVYDFCKKLLTLPKP
FCTIGLDYAARLKMERTTPGMLYQRMVISEQSLRSDPYPYQEKIFIFADPELLSEAICKA
LLTDTEAARVSQSPRACMCYVITHTVQAALGEGCDLSALRTRLQGMPSSEVEHWFQEVVM
AVECTGSQVAADRGQHVERLQSIYSAILSSSPPGDAPLEGLQGTPLPNPNISFHLWTEDD
QLWKELVLFIRPLSQSCEPDRLSQDLDNFEIQDIISDCECCEQTRFSVLSTDSGIERDLP
PSAEEPFAPCSADTEQSRLHRKGGIKKKPSPLESVAFLQTGCNGPGAKPAAKVQRRVGIP
TEPTAPLLRLHTARIVLLGDDRILGRLAQAYHSLRKRETRRVFLTPRLNLQFYYVPVTGQ
PGTPAAANPSATSPEELCEVAAYLGRADPWYESNINTLCHMIPKLATMPSSPSKHLVTDL
FITDVIAYYVRMGAQPVCFQVYAVKVFFSSSAQEPAEDVFLTELCAQVQDSISSREVNPT
KKKTTLDGPGIDLTVTYRKVVVSDRAKEVSLSLRSTGLSMKAIPANTAEDLACLNVNITE
VVRINNLSGRSFSTVANKLKTCNIKIRSTEQRPFTLCLDKDSRRTYRSVVSLEVSPCLEP
SYCLQKSRTMKFSLQEAEDVGLVKYMPKSLLLPINTFAGVIQ
NT seq 2289 nt   +upstreamnt  +downstreamnt
atgctctgctgcaaccccggcccagccatggagagcgcagaggtggagtcggacatcctg
cgccgtgtccgcacgctgctgcgcgagctggacggccaccaccccgcctgccagcgtgac
cgagggatgctgcgatggaccctgcacaaaaaaattgaccagaatcccagtaacagcccc
atcctggtccggatcctggtgaaagagctggagagggcagagcgaggtgactacaggcat
tacatcatccctctgctgcacacgctgatgtacgccttgatcaaggctccctgcatctcc
gacgagctctgcagcagagtgtatgatttctgcaagaagctgctcaccctgcccaagcct
ttctgcaccattggtttggactacgctgccaggctgaagatggaaaggacaacaccaggg
atgctctaccaaaggatggtgatttccgaacaaagtcttagaagcgacccctacccctac
caggaaaagattttcatcttcgccgacccggagctgctctccgaagccatctgcaaggct
ctgctcaccgacacggaggcagctcgtgtctcccagagcccgcgggcgtgtatgtgctat
gtgattacccacactgtgcaggcagccctgggcgagggctgtgacctcagcgccttgagg
acgaggctccagggcatgcccagcagcgaggttgagcactggttccaggaggtggtgatg
gctgtcgagtgcacggggagccaagtggctgcagaccgcgggcagcacgtggaaaggctg
cagagcatctacagtgccatcctcagctcctcgccaccaggcgatgctcccctggaaggg
ctgcagggcaccccgctgcccaaccccaacatcagcttccacctctggacagaagatgat
cagctctggaaggagctggtgctgttcatccgcccgctgtcgcagagctgcgagccggat
cgcctgagccaggacctggacaacttcgagatccaggacatcatttcagactgcgagtgc
tgcgagcagacccgcttctccgtgctctctaccgacagtggcatcgagcgggacctgcca
ccgagtgccgaggagccctttgccccgtgcagtgctgacacggagcaatcccggctccat
aggaaaggtggcattaaaaaaaagccctcgccgctggaaagtgtggccttcctgcagact
ggctgcaacggccccggggcgaagcctgcagccaaggtgcagaggagagtggggatccct
actgagcccacggccccgctgctgaggctgcacactgcccgcattgtgctgctgggggac
gaccgcatcctggggcgcctggcacaagcctaccactccctgcggaagcgagagacacga
cgtgtcttcctgaccccaaggctaaacctgcagttctactacgtgccggtgaccgggcag
ccgggcacgccggcagctgcgaacccctctgccaccagccctgaggagctctgcgaggtg
gctgcctacctgggcagagccgatccctggtatgagagcaacatcaacacgctgtgccac
atgatccccaagctggccaccatgccttcctctccgagcaagcatctggtgactgatctc
ttcatcactgatgtgattgcctactacgtccgcatgggcgcccagcccgtctgcttccag
gtgtacgcagtgaaggttttcttcagcagctcagcacaggagccggctgaggatgtgttc
ctgacggagctgtgtgcccaggtgcaggacagcatctcctccagagaggtaaacccaacc
aagaagaagacgaccctggatggccctggcatagatctgactgtaacatacaggaaggtc
gtggtgagtgaccgggcaaaggaggtgtcgctgtccctgcgctccacgggtctctcaatg
aaggccatccctgccaacacagctgaagatctggcgtgtctaaatgtgaacatcaccgaa
gttgttaggatcaacaacttgtcaggacggtccttctcaaccgtggcaaacaagttgaag
acgtgcaacatcaaaatcaggagcacggagcagaggcccttcacactgtgtctggacaag
gacagcagaaggacctacaggagtgtggtcagcctggaagtgtctccttgcctagagccc
agctactgcctgcaaaagtcaaggacaatgaagttcagcctgcaagaagcagaggatgtg
ggacttgtgaaatacatgcccaagtctctgctgctgcccatcaacacgtttgcaggtgtc
atccaatga

DBGET integrated database retrieval system