KEGG   Gallus gallus (chicken): 417739
Entry
417739            CDS       T01006                                 

Gene name
MAPK11
Definition
(RefSeq) mitogen-activated protein kinase 11
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04068  FoxO signaling pathway
gga04114  Oocyte meiosis
gga04218  Cellular senescence
gga04261  Adrenergic signaling in cardiomyocytes
gga04370  VEGF signaling pathway
gga04620  Toll-like receptor signaling pathway
gga04621  NOD-like receptor signaling pathway
gga04622  RIG-I-like receptor signaling pathway
gga04625  C-type lectin receptor signaling pathway
gga04912  GnRH signaling pathway
gga04914  Progesterone-mediated oocyte maturation
gga05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    417739 (MAPK11)
   04370 VEGF signaling pathway
    417739 (MAPK11)
   04068 FoxO signaling pathway
    417739 (MAPK11)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    417739 (MAPK11)
   04218 Cellular senescence
    417739 (MAPK11)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    417739 (MAPK11)
   04621 NOD-like receptor signaling pathway
    417739 (MAPK11)
   04622 RIG-I-like receptor signaling pathway
    417739 (MAPK11)
   04625 C-type lectin receptor signaling pathway
    417739 (MAPK11)
  09152 Endocrine system
   04912 GnRH signaling pathway
    417739 (MAPK11)
   04914 Progesterone-mediated oocyte maturation
    417739 (MAPK11)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    417739 (MAPK11)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    417739 (MAPK11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    417739 (MAPK11)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     417739 (MAPK11)
Protein kinases [BR:gga01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   417739 (MAPK11)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Kdo APH Kinase-like
Other DBs
NCBI-GeneID: 417739
NCBI-ProteinID: NP_001006227
CGNC: 6538
Ensembl: ENSGALG00000040023
UniProt: Q5ZIK8
Position
1
AA seq 361 aa
MSERGGFYRQELNKTVWEVPQRYQNLTPVGSGAYGSVCSAYDTKTRQKVAVKKLSRPFQS
LIHARRTYRELRLLKHMKHENVIGLLDVFTPATSIENFNEVYLVTNLMGADLNNIVKCQK
LTDDHIQFLIYQLLRGLKYIHSAGIIHRDLKPSNLAVNEDCELRILDFGLARQTDDEMTG
YVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLKGKALFPGDDYIDQLKRIMEVVGT
PSSELLKKISSEHARKYFESLPHMPQQDLKAVFRGANPLAVDLLEKMLILDSDKRITASA
ALAHPYFVQYHDPDDEPEAELYDESIENKERTIEEWKELTYEEVMSFKPPDLKMDSLEIE
Q
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgtccgagcgcggcggcttctaccggcaggagctgaacaagacggtgtgggaggtgccg
cagcgctaccagaacctcacccccgtgggctcgggcgcctacggctccgtgtgttcagct
tatgataccaaaacaagacagaaggtggcagtaaaaaagctttcaagacctttccaatca
cttattcacgcaaggaggacctaccgagagctcaggctgctgaagcacatgaagcatgag
aatgttataggattgctggatgtttttacacctgctacatcaatagaaaattttaatgaa
gtgtatcttgtgacaaatttaatgggtgctgacctaaataacattgtgaagtgccagaag
ttaacagatgaccatatacagtttcttatatatcagttacttcgaggacttaagtatatt
cactcggctggaatcatccacagggacctgaagcccagtaacttagctgtaaatgaagac
tgtgaattgaggattttagactttggtttagctcgacaaaccgatgatgaaatgactggc
tacgttgcaacaagatggtacagagctccagaaatcatgttgaactggatgcactacaat
caaacagttgacatctggtctgttggttgcatcatggcagagttattgaaagggaaggcc
ctgtttccgggagatgattatattgatcaactgaagagaataatggaggttgtgggtaca
cccagttctgagcttctgaagaagatatcatcagaacacgcaagaaagtactttgaatct
cttccacatatgcctcaacaggatttgaaggcagtgtttcgtggtgccaatccgctagcg
gtagaccttcttgagaagatgctgatattggacagtgataaaagaattactgcctcggca
gcgctcgcacatccatactttgtacagtatcatgatccggatgacgaacctgaggccgag
ctctatgatgagtcaatagagaataaagagcgaaccatagaagaatggaaagaacttacc
tacgaagaagtgatgagctttaaaccacctgacctgaaaatggatagcctggaaatagaa
cagtga

KEGG   Gallus gallus (chicken): 421183
Entry
421183            CDS       T01006                                 

Gene name
MAPK14
Definition
(RefSeq) mitogen-activated protein kinase 14 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04068  FoxO signaling pathway
gga04114  Oocyte meiosis
gga04218  Cellular senescence
gga04261  Adrenergic signaling in cardiomyocytes
gga04370  VEGF signaling pathway
gga04620  Toll-like receptor signaling pathway
gga04621  NOD-like receptor signaling pathway
gga04622  RIG-I-like receptor signaling pathway
gga04625  C-type lectin receptor signaling pathway
gga04912  GnRH signaling pathway
gga04914  Progesterone-mediated oocyte maturation
gga05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    421183 (MAPK14)
   04370 VEGF signaling pathway
    421183 (MAPK14)
   04068 FoxO signaling pathway
    421183 (MAPK14)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    421183 (MAPK14)
   04218 Cellular senescence
    421183 (MAPK14)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    421183 (MAPK14)
   04621 NOD-like receptor signaling pathway
    421183 (MAPK14)
   04622 RIG-I-like receptor signaling pathway
    421183 (MAPK14)
   04625 C-type lectin receptor signaling pathway
    421183 (MAPK14)
  09152 Endocrine system
   04912 GnRH signaling pathway
    421183 (MAPK14)
   04914 Progesterone-mediated oocyte maturation
    421183 (MAPK14)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    421183 (MAPK14)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    421183 (MAPK14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    421183 (MAPK14)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     421183 (MAPK14)
Protein kinases [BR:gga01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   421183 (MAPK14)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Kdo APH Kinase-like
Other DBs
NCBI-GeneID: 421183
NCBI-ProteinID: XP_001232616
CGNC: 13975
UniProt: A0A1D5PIQ5
Position
26
AA seq 360 aa
MSQERPKFYRQELNKTVWEVPERYQNLSPVGSGAYGSVCSAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPAKSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGPELLKKISSESARNYIQSLSYMPKMNFENVFIGANPLAVDLLEKMLVLDTDKRITAA
EALAHAYFAQYHDPDDEPVADPYDQSFESRELEIEEWKSLTYDEVISFVPPPLDQEEMES
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgtctcaggagcggcccaagttttaccgccaggagctcaacaagacggtgtgggaggtg
cccgagcgctaccaaaacctctccccggtcgggtccggggcctacggctccgtctgttct
gcctttgacacaaagactggattgcgcgtggctgtaaagaagctttcccgaccatttcag
tctatcatccatgccaaaaggacctaccgagaactacggctactgaagcatatgaaacac
gaaaatgtgatcggcttgctagatgtgttcacccctgccaagtctctagaagaattcaat
gatgtgtacttggtgacacacctcatgggagcagatctaaacaacattgtgaaatgccag
aaacttacagatgaccacgtgcagttcctcatataccagattcttcgggggctgaagtac
atccattcagctgacataatacacagagatttaaaacctagtaacttagctgtaaatgaa
gactgtgagctgaagatcctggattttggcttggctcgacacacggatgatgagatgacc
ggatatgtggctacccggtggtacagagctcctgagatcatgctgaactggatgcattac
aaccagacagttgatatttggtcagtgggatgcattatggctgaactgttgactggaaga
acattgttccctggtacagaccatattgatcagttgaagctcattttgagactcgttgga
accccagggcctgagcttttgaagaaaatctcctcagagtctgcgagaaactacattcaa
tctttgtcttacatgccgaaaatgaactttgaaaatgtgtttattggtgccaatccatta
gctgtggacttgctagagaagatgttggtactggatacagacaaacgaattactgcagca
gaagcgttggctcacgcctactttgctcagtatcatgacccagatgacgaaccagtggca
gacccctacgaccagtcttttgaaagcagagagctggagattgaggaatggaaaagcctg
acttacgatgaagtaatcagctttgtgccaccgccgcttgaccaagaggagatggagtcc
tga

KEGG   Gallus gallus (chicken): 769763
Entry
769763            CDS       T01006                                 

Gene name
MAPK12
Definition
(RefSeq) mitogen-activated protein kinase 12
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04068  FoxO signaling pathway
gga04114  Oocyte meiosis
gga04218  Cellular senescence
gga04261  Adrenergic signaling in cardiomyocytes
gga04370  VEGF signaling pathway
gga04620  Toll-like receptor signaling pathway
gga04621  NOD-like receptor signaling pathway
gga04622  RIG-I-like receptor signaling pathway
gga04625  C-type lectin receptor signaling pathway
gga04912  GnRH signaling pathway
gga04914  Progesterone-mediated oocyte maturation
gga05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    769763 (MAPK12)
   04370 VEGF signaling pathway
    769763 (MAPK12)
   04068 FoxO signaling pathway
    769763 (MAPK12)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    769763 (MAPK12)
   04218 Cellular senescence
    769763 (MAPK12)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    769763 (MAPK12)
   04621 NOD-like receptor signaling pathway
    769763 (MAPK12)
   04622 RIG-I-like receptor signaling pathway
    769763 (MAPK12)
   04625 C-type lectin receptor signaling pathway
    769763 (MAPK12)
  09152 Endocrine system
   04912 GnRH signaling pathway
    769763 (MAPK12)
   04914 Progesterone-mediated oocyte maturation
    769763 (MAPK12)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    769763 (MAPK12)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    769763 (MAPK12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    769763 (MAPK12)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     769763 (MAPK12)
Protein kinases [BR:gga01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   769763 (MAPK12)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase Kdo Kinase-like
Other DBs
NCBI-GeneID: 769763
NCBI-ProteinID: XP_001233062
CGNC: 13849
Ensembl: ENSGALG00000019384
UniProt: F1NLU9
Position
1
AA seq 361 aa
MSSPKNGFYQQEITKTLWEVRDRYRDLQPVGSGAYGTVCSAVDGRSGAKVAIKKLYRPFQ
SQILAKRAYRELRLLKHMKHENVIGILDVFTPDVTLEKFNGFYLVMPFMGTDLSKIMKHE
KLTEDRIQFLVYQILKGLKYIHSSGIIHRDLKPGNLAVNEDCELKILDFGLARHTDSEMT
GYVVTRWYRAPEVILNWMHYTQTVDIWSVGCIMAEMITGRPLFRGNDHLDQLTEIMKITG
TPSQDFVQKLKSQDAKNYIKSLPKVQKKDFASVLKHASPLAVNLLENMLVLDAEERVTAA
EALMHPYFEPIHDPEEEIEAEKYDDTFDNMDLPLDEWKRITYKEILNFKPPQTSESKETA
V
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgtcctcccccaagaacggcttctaccaacaggagatcaccaaaaccctctgggaagtg
cgggaccgctaccgggacctgcagcccgtgggctccggcgcctacggaaccgtctgctcc
gctgtggatggaagaagcggcgccaaagtggccattaagaagctgtaccgcccctttcag
tcccagatccttgccaagagagcctaccgagagctgcgcctcctgaagcacatgaagcac
gaaaacgtcattggaatactggatgtgttcacaccagatgtcacactggagaaatttaac
ggcttctacctggtcatgccatttatgggaacagacttaagtaagataatgaagcatgag
aaactcactgaagaccgaatccagttcttggtatatcagatattgaaaggcttaaagtat
attcactcatctggcataattcacagggatctaaagcctggaaacctggcagtaaatgaa
gactgcgaactgaagatcctggattttggattggccaggcatacggacagtgagatgaca
ggttacgtggttacaaggtggtacagagccccagaggtcatccttaattggatgcattac
acacaaacagttgacatctggtctgtgggctgtataatggctgaaatgataacggggagg
cctctgttcaggggaaacgaccatctggaccaactcacagaaataatgaaaataacgggt
acgccaagtcaagattttgtgcaaaaactgaagagtcaggatgcaaaaaactatatcaaa
agccttccaaaagtccagaaaaaagattttgcatccgtcttgaagcacgcgagtcctttg
gctgtaaatcttttggagaacatgctggtgctggatgcggaggagcgagtcacggcagct
gaggctttgatgcacccttactttgaaccaattcacgatcctgaggaagaaatcgaggct
gagaaatatgatgacacatttgataacatggatctgcccctggatgagtggaagcgtatt
acatataaagagatactgaacttcaagccaccacaaacatcagagtcaaaggagacagcg
gtgtaa

KEGG   Gallus gallus (chicken): 771145
Entry
771145            CDS       T01006                                 

Gene name
MAPK13
Definition
(RefSeq) mitogen-activated protein kinase 13 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04068  FoxO signaling pathway
gga04114  Oocyte meiosis
gga04218  Cellular senescence
gga04261  Adrenergic signaling in cardiomyocytes
gga04370  VEGF signaling pathway
gga04620  Toll-like receptor signaling pathway
gga04621  NOD-like receptor signaling pathway
gga04622  RIG-I-like receptor signaling pathway
gga04625  C-type lectin receptor signaling pathway
gga04912  GnRH signaling pathway
gga04914  Progesterone-mediated oocyte maturation
gga05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    771145 (MAPK13)
   04370 VEGF signaling pathway
    771145 (MAPK13)
   04068 FoxO signaling pathway
    771145 (MAPK13)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    771145 (MAPK13)
   04218 Cellular senescence
    771145 (MAPK13)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    771145 (MAPK13)
   04621 NOD-like receptor signaling pathway
    771145 (MAPK13)
   04622 RIG-I-like receptor signaling pathway
    771145 (MAPK13)
   04625 C-type lectin receptor signaling pathway
    771145 (MAPK13)
  09152 Endocrine system
   04912 GnRH signaling pathway
    771145 (MAPK13)
   04914 Progesterone-mediated oocyte maturation
    771145 (MAPK13)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    771145 (MAPK13)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    771145 (MAPK13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    771145 (MAPK13)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     771145 (MAPK13)
Protein kinases [BR:gga01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   771145 (MAPK13)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Kdo Kinase-like FTA2 DUF5898
Other DBs
NCBI-GeneID: 771145
NCBI-ProteinID: XP_001234443
CGNC: 536
Ensembl: ENSGALG00000030966
Position
26
AA seq 365 aa
MNFTRRRGFYRQELNRTIWELPRRYTSLHPVGSGAYGSVCSAIDKKTGEKVAIKKLCRPF
QSEIFAKRAYRELTLLKQMQHENVIGLLDVFTSAPSYHGFQDFYLVMPYMRTDLQKIMGH
EFSDEKIQYLVYQMLKGLKYIHSAGIIHRDLKPGNLAVNEDCQLKILDFGLARHADAEMT
GYVVTRWYRAPEVILNWMHYNQTVDIWSIGCIMAEMLTGKTLFKGKDYVDQLTQILKVTG
HPGDDFVEKLEDKAAKSYIKSLPKMPKKDLSVLFPTANPQAVDLLDKMLQLDVEKRLTAT
EALAHPYFDQFRDIEEETEAQQSYDDSLEREKLSIEEWKKHIYKEILSFSPIAQKDSKKR
SGMSL
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgaacttcacaaggagaagaggcttttacagacaggagctgaacagaaccatctgggag
ctgcccaggaggtacacctccctgcaccccgtgggctctggggcctacggttccgtctgc
tccgccatagacaagaagacaggagagaaagtggccatcaagaagctgtgccgcccattc
cagtcggagatctttgccaagagagcgtacagagagctcacgctcttgaagcaaatgcag
catgagaatgtcattgggctgcttgatgtcttcacctccgccccttcctaccacggattc
caggacttctacctggtgatgccatacatgcggacagatttacaaaagatcatgggacat
gaattcagtgatgaaaagatccagtacctggtctaccagatgctgaaagggctgaagtat
attcattctgccggaatcatccacagggacctgaagccaggcaacctggctgtgaatgaa
gactgccagctaaagatcttggactttggcttggcaagacatgctgatgctgaaatgaca
ggctatgtggtcacgcgctggtatagagctccagaagtcattctgaactggatgcattac
aaccagacagtggatatctggtctattggttgcatcatggcagaaatgctgactggaaaa
acgctgtttaaaggaaaagactacgttgatcagctgactcagatcctgaaagtaacaggg
catcccggagatgactttgtggagaagcttgaggacaaggcggctaaaagttatatcaag
tctcttccaaaaatgcccaagaaggatttgtctgtgctcttccccacagccaatcctcag
gcagtggacctgctggacaagatgctgcagctggatgtggagaagcgccttacggccaca
gaagcattagcccacccatactttgatcaattccgagacattgaggaggagacagaggca
caacagtcctacgatgattctctggagcgtgaaaagctttcaatagaagaatggaaaaaa
catatctacaaggagatcttatccttcagtccaattgcacagaaggactcaaagaagcga
agtggaatgtcgctgtag

DBGET integrated database retrieval system