KEGG   Gallus gallus (chicken): 419313
Entry
419313            CDS       T01006                                 

Gene name
GNAS
Definition
(RefSeq) guanine nucleotide-binding protein G(s) subunit alpha isoform X1
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
gga  Gallus gallus (chicken)
Pathway
gga04020  Calcium signaling pathway
gga04261  Adrenergic signaling in cardiomyocytes
gga04270  Vascular smooth muscle contraction
gga04540  Gap junction
gga04912  GnRH signaling pathway
gga04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    419313 (GNAS)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    419313 (GNAS)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    419313 (GNAS)
   04916 Melanogenesis
    419313 (GNAS)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    419313 (GNAS)
   04270 Vascular smooth muscle contraction
    419313 (GNAS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    419313 (GNAS)
   04031 GTP-binding proteins [BR:gga04031]
    419313 (GNAS)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   419313 (GNAS)
  Exosomal proteins of other body fluids (saliva and urine)
   419313 (GNAS)
  Exosomal proteins of colorectal cancer cells
   419313 (GNAS)
  Exosomal proteins of bladder cancer cells
   419313 (GNAS)
GTP-binding proteins [BR:gga04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    419313 (GNAS)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB GTP_EFTU Rad17 AAA_29
Other DBs
NCBI-GeneID: 419313
NCBI-ProteinID: XP_024998120
CGNC: 50967
Ensembl: ENSGALG00000030859
Position
20
AA seq 417 aa
MGLCYSLRSRLAAAHPSVPYGGRGEADPAAAEQQQQCGDPQVRHRLRQDLVAKERADKKR
SKSIDKTLKAEKREYKQTHRLLLLGAGESGKSTIVKQMRILHVNGFNAEEKKMKIQDIKN
NIKEAIETIVTAMGNLAPPVELANPENQFRIDYILNLANQIDFDFPPEFYEHTKTLWQDD
GVKACYERSNEYQLIDCAQYFLDKIDIVKQNEYTPSDQDLLRCRVLTSGIFETKFQVDKV
NFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIW
NNRWLRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPDDATPEPGEDPRVTRA
KYFIRDEFLRISTASGDGRHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL
NT seq 1254 nt   +upstreamnt  +downstreamnt
atggggctgtgctacagcctgcgctcccgcctggccgccgcgcacccctccgtgccctac
ggcggccgcggcgaggcggacccggcggcggcggagcagcagcagcagtgcggagatccg
caggtgcggcaccggctgcggcaggacctggtggccaaggagcgggcggataagaagcgg
agcaagagcatcgataagacgctgaaggcggagaagagggagtacaagcagacgcaccgg
ctgctgctgctcggtgctggtgaatctggtaaaagcacaatagtcaaacagatgaggatt
ttgcatgtgaatggatttaatgctgaggaaaagaaaatgaaaattcaggatattaagaac
aatattaaagaagctatagagacaatagtgacagcaatgggcaacttggcacctccagtt
gaactagccaatccagagaaccagtttcgaatcgactacatcttaaatttagctaaccag
atagacttcgatttcccaccggagttttatgaacacacgaaaacactttggcaagacgac
ggtgtgaaagcctgctatgagagatctaatgaatatcagctgattgattgtgcgcagtat
tttctagacaagattgacatagtcaaacaaaatgagtatacaccatctgaccaggatctt
ctcagatgcagagttttgacatcaggaatttttgaaaccaagtttcaagtggacaaagta
aattttcatatgtttgatgttggagggcaacgagatgaacgccgaaaatggatccagtgt
tttaatgatgtgactgctatcatatttgtggtggccagcagtagctacaacatggttata
cgagaggacaatcagaccaaccggcttcaagaagcactaaatctcttcaagagtatctgg
aacaacaggtggctacggaccatttcagtaattcttttcctgaataaacaagatttgcta
gcagagaaagttttggcagggaaatctaaaattgaagactactttccagaatttgctcgc
tacactacaccagatgatgcaacaccagagcctggtgaggatcccagagttacaagggcc
aagtattttattagagacgagtttcttagaatcagcacagcaagtggagatggaaggcac
tattgctatcctcacttcacatgtgcagtggatacagagaacatccggagggttttcaat
gactgtcgggacattattcagcgcatgcaccttcgccaatacgagttgttgtga

DBGET integrated database retrieval system