KEGG   Gallus gallus (chicken): 419580
Entry
419580            CDS       T01006                                 

Gene name
SLC9A1
Definition
(RefSeq) sodium/hydrogen exchanger 1 precursor
  KO
K05742  solute carrier family 9 (sodium/hydrogen exchanger), member 1
Organism
gga  Gallus gallus (chicken)
Pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
gga04371  Apelin signaling pathway
gga04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    419580 (SLC9A1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    419580 (SLC9A1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    419580 (SLC9A1)
   04261 Adrenergic signaling in cardiomyocytes
    419580 (SLC9A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gga01009]
    419580 (SLC9A1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gga02000]
    419580 (SLC9A1)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     419580 (SLC9A1)
Transporters [BR:gga02000]
 Solute carrier family (SLC)
  SLC9: Na+/H+ exchanger
   419580 (SLC9A1)
SSDB
Motif
Pfam: Na_H_Exchanger NEXCaM_BD OprF
Other DBs
NCBI-GeneID: 419580
NCBI-ProteinID: NP_001038108
CGNC: 615
Ensembl: ENSGALG00000034251
UniProt: Q1PS52
Position
23
AA seq 803 aa
MGAAALRALPWALLLLLGPLLPGQRLQADATRVSEPTWEQPWGEPGGITAAPLATAQEVH
PLNKQHHNHSAEGHPKPRKAFPVLGIDYSHVRIPFEISLWILLACLMKMGFHVMSSVSKV
VPESCLLIVVGLLVGGLIKAVGEKPPILKSDIFFLFLLPPIILDAGYFLPLRQFTENLGT
ILIFAVVGTLWNAFFLGGLMYAVCQIGGSGLNHIGLLANLLFGSIISAVDPVAVLAVFEE
IHINELLHILVFGESLLNDAVTVVLYHLFEEFANFEQVTIIDMVLGFLSFFVVSLGGVFV
GVIYGLIAAFTSRFTSNIRVIEPLFVFLYSYMAYLSAEIFHLSGIMALIASGVVMRPYVE
ANISHKSHTTIKYFLKMWSSVSETLIFIFLGVSTVAGQHYWNWTFVISTLLFCLIARVLG
VLVLTWFINKFRIVKLTPKDQFIIAYGGLRGAIAFSLCYLLDYEHFNMRDMFLTAIITVI
FFTVFVQGMTIRPLVDLLAVKKKQETKRSINEEIHTQFLDHLLTGIEDICGHYGHHHWKD
KLNRFNKKYVKKCLIAGERSKEPQLIAFYHKMEMKQAIELVESGGLGKIPSTISAVSIQN
ISPKTLPDSNALSALSKDKEDEIRKILRSNLQKTRQRLRSYNRHTLVADPYEDVWNQMLM
KRQKMQQAELQLQNAYLTVPANRIDSPTMSRARIGSDPLAYEPKPDSENLPIITIDPASP
QSPESMDLSNEVPKGCGGLPPSPEEDEEGLVMRPKEPSSPGTDDVFTPGTSDSPSSQRML
RCLSDPGPRQEPEEGEPFIPKGQ
NT seq 2412 nt   +upstreamnt  +downstreamnt
atgggggccgcggccctccgagcccttccctgggctctgctgctgctgctgggcccgctg
ctgcccggccagcgcttgcaggccgacgccacgcgtgtctccgagcccacctgggagcag
ccgtggggagagcccgggggtatcaccgccgccccgctggccacggcccaggaggtgcac
ccgctgaacaaacagcaccacaaccactcggccgaggggcacccgaagccccgcaaagct
ttccccgtgctgggcatcgactactcgcacgtccgcatccccttcgagatctcgctctgg
atcctgctggcctgcctgatgaagatgggcttccacgtgatgtcctcagtgtccaaagtg
gttcccgagagctgcctgctcatcgtggtgggcctcctggtcggggggctcatcaaagcg
gtgggcgagaagccccccatcctcaaatcggacatcttcttcctcttcctcctccctccc
atcattctggacgccggctacttcctccccttgcggcagttcaccgagaacctgggcacc
atcctcatcttcgccgtggtggggacgctgtggaatgcgttcttcctgggggggctgatg
tacgccgtgtgccagattggaggcagcggcctcaaccacatcggcctgctggccaacctg
ctgttcggcagcatcatctcggccgtggacccggtggccgtgctggccgtcttcgaggag
atccacatcaacgagctgctgcacatcctggtcttcggggagtccctgctgaacgacgcc
gtcacggtggtcctctaccacctttttgaggagtttgccaactttgagcaagtgaccatt
atcgatatggtccttggcttcctcagcttcttcgtggtgtctctgggcggcgtcttcgtg
ggcgtcatttatgggctgattgctgccttcacgtcccgcttcacctccaacatccgcgtc
atcgaacccctcttcgtcttcctctacagctacatggcctatctctctgctgagatcttc
cacctctccggcatcatggcgctcatcgcctccggcgtggtcatgcggccctacgtggaa
gccaacatctcccacaagtcccacaccaccatcaagtacttcctcaagatgtggagcagc
gtgagcgagaccctcatcttcatcttcctgggcgtctccaccgtggctggccagcactac
tggaactggaccttcgtcatcagcacgctgctattctgcctcatcgccagggttttgggc
gtcctggtgctcacctggttcatcaacaagttccgcatcgtgaagctgacaccgaaggat
cagttcatcattgcgtacgggggcctgcggggggccatcgccttctccctctgttacctc
ctggactacgagcacttcaacatgagggacatgttcctcacggccatcatcaccgtcatc
ttcttcaccgtcttcgtgcagggcatgaccatccggcccctggtggatctgctcgccgtg
aagaagaagcaggagacgaagcgctccatcaacgaggagatccacacgcagttcctggat
caccttctgacggggatcgaggacatctgcggtcactacgggcaccaccactggaaggac
aagctgaatcgcttcaacaagaagtacgtgaagaagtgcctgatagcaggagagcgctcc
aaggagccgcagctcatcgctttctatcacaagatggagatgaagcaggccatcgagctg
gtggagagcgggggcttgggcaagatcccctccaccatctccgctgtctccatccagaac
atcagccccaagaccctccccgactcaaacgccctctcggccctgtccaaggacaaggag
gatgagatccggaaaatccttcgcagcaacctgcagaaaaccaggcagaggctgcgatcc
tacaaccggcacacgttggtggctgacccctacgaggacgtctggaaccaaatgctgatg
aagaggcagaaaatgcagcaagcagaactccagttgcagaacgcctacctgacggtgcca
gctaacaggatcgattcccccaccatgtcccgggctcgcatcggctcagacccgttggcc
tacgaacccaaaccggactcggagaacctccccatcatcaccatcgacccggcctccccg
cagtccccggagtcgatggacctgagcaacgaggtgcccaagggctgcggcggcctgccg
ccctccccggaggaggatgaggaggggttggtgatgaggcccaaggagccttcctccccc
ggcaccgacgacgtcttcacccccgggaccagcgacagccccagcagccagcggatgctg
cggtgtctgagcgacccggggccgcggcaggagccggaggagggggagcccttcatcccc
aaggggcagtag

DBGET integrated database retrieval system