KEGG   Gallus gallus (chicken): 421508
Entry
421508            CDS       T01006                                 

Gene name
RYR2
Definition
(RefSeq) ryanodine receptor 2 isoform X1
  KO
K04962  ryanodine receptor 2
Organism
gga  Gallus gallus (chicken)
Pathway
gga04020  Calcium signaling pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
gga04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    421508 (RYR2)
   04020 Calcium signaling pathway
    421508 (RYR2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    421508 (RYR2)
   04261 Adrenergic signaling in cardiomyocytes
    421508 (RYR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:gga04040]
    421508 (RYR2)
   04990 Domain-containing proteins not elsewhere classified [BR:gga04990]
    421508 (RYR2)
Ion channels [BR:gga04040]
 Voltage-gated cation channels
  Ryanodine receptor
   421508 (RYR2)
Domain-containing proteins not elsewhere classified [BR:gga04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   421508 (RYR2)
SSDB
Motif
Pfam: RYDR_ITPR RyR RR_TM4-6 SPRY Ins145_P3_rec MIR RIH_assoc Ion_trans EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8
Other DBs
NCBI-GeneID: 421508
NCBI-ProteinID: XP_025004802
CGNC: 8217
Ensembl: ENSGALG00000010812
Position
3
AA seq 4987 aa
MAEGGEGEDEIQFLRTDDEVVLQCTATVHKEQQKLCLAAEGFGNRLCFLESTSNSKNVPP
DLSICTFVLEQSLSVRALQEMLANTEEKAEGLVDVEKWKFMMKSAQGGGHRTLLYGHAIL
LRHSYSGMYLCCLSTSRSSMDKLAFDVGLQEDTTGEACWWTIHPASKQRSEGEKVRVGDD
LILVSVSSERYLHLSYGNGSLHVDAAFQQTLWSVAPISSGSEFAQGYLIGGDVLRLLHGH
MDECLTVPSGEHGEEQRRTVHYEGGAVSIHARSLWRLETLRVAWSGSHIRWGQPFRLRHI
TTGKYLSLLDDKSLLLTDKEKADIKSTAFCFRSSKEKLDVGMRKEVDGMGTPEIKYGDSI
CFIQHVDTGLWLSYQSADAKSVRMGSVQRKAIMHHEGHMDDGLTLSRSQHEESRTARVIR
STVFLFNRFIRGLDALSKKVKSSTVDLPIESVSLSLQDLIGYFHPPDEHLEHEDKQNRLR
ALKNRQNLFQEEGMINLVLECIDRLNVYSSAAHFADVAGKEAGEAWKSILNSLYELLAAL
IRGNRKNCAQFSGSLDWLISRLERLEASSGILEVLHCVLVESPEALNIIKEGHIKSIICL
LDKHGRNHKVLDVLCSLCVCHGVAVRSNQHLICDNLLPGRDLLLQTRLVNHVSSMRPNIF
LGISEGSAQYRKWYYELMVDHLEPFVTAESTHLRVGWASTEGYSPYPGGGAEWGGNGVGD
DLYSYGFDGLHLWSGCVARTVNSPNQHLLRTEDVISCCLDLSAPSISFRINGQPVQGMFE
NFNIDGLFFPVVSFSAGIKVRFLLGGRHGEFKFLPPPGYAPCFEAVLPKEKLKVEHSREY
KQDRNYTRDLLGPTLNLSQAAFTPVPVDTSQIVLPPHLERIREKLAENIHELWVMNKIEL
GWQYGPVRDDNKRQHPCLVEFSKLPEQERNYNLQMSLETLKTLLALGCHVGIADERAEEK
VKKMKLPKNYQLLSGYKPAPMDLSFIKLTPSQEAMVDKLAENAHNVWARDRIRQGWTYGI
QQDVKNRRNPRLVPYALLDDRTKKSNKDSLREAVRTLLGYGYNLEAPDQDHATRVDMSNG
IMEKFRIFRTEKTYAVKSGKWYFEFEAVTAGDMRVGWTRPGCLPDQELGSDEEAFVFDGF
KAQRWHQGNEHFGRSWLAGDVVGCMVDMNEHTMMFTLNGEILLDDSGSELAFKDFEVGDG
FLPVCSLGPSQVGRMNFGKDVSTLKYFTICGLQEGYEPFAVNTNRDITIWLSKRLPQFLP
VPQNHEHIEVMRIDGTIDTCPCLKVTQKSFGSQNSKTDVMFFRLSMPIECAEVFSRTAAG
GLPGTGLFGPKNDLEDYDADSDFEVLMKTAHGHLAADRTEREKDATKPELNNHKDYVQEK
PSRLKQRFMLRRTKPDYSTSHSARLTEDVLADDRDDYDYLMQTSTYYYSVRIFPGQEPAN
VWVGWITSDFHQYDTSFDLDRVRTVTVTLGDEKGKVHESIKRSNCYMVCAGESMSPGQGR
NNNGLEIGCLVDAASGLLTFTANGKELGTYYQVEPSTKLFPAVFAQATSPNVFQFELGRI
KNVMPLSAGLFKSEHKNPVSQCPPRLHVQFLTHVLWSRVPNHFLKVDVSRISERQGWMIQ
CLNPLQFMALHIPEENRTIDILELTEQEELLKFHYHTLRLYSAVCALGNNRVAHAMCSHV
DESQLLYAIENKYMPGLLRAGYYDLLIDIHLNTYATARLMMNNEFIVPMTDETKSITLFP
DENKKHGLPGIGLSTSLRPRMQFSSPSFVSINSECFQFSPEFPLEILKAKTIEMLTEAVQ
EGSLHVRDPVGGSTEFLFVPLIKLFYTLLIMGIFHNGDLKHILQLIEPRVFKEAASLEDE
KDLSEKELSSDELKSGEEESRGEQVPKEGLLQMKLPEPVKLQMCHLLQYLCDCQVRHRIE
AIVAFSDDFVAKLQENQRFRYNEVMQALNMSAALTARKTKEFRSPPQEQINMLLNFKDDK
TDCPCPEEIRDQLLDFHEDLMTHCGIELDEDGTLDGNSDLTIRGRLLYLVEKVTYLKKKQ
AEKPVDDDAKTSSTLQQLISDTMVRWAQESVIEDPELVRAMFVLLHRQYDGIGGLVRALP
KTYTINSVSVEDTINLLASLGQIRSLLSVRMGKEEEKLMIRGLGDIMNNKVFYQHPNLMR
ALGMHETVMEVMVNVLGGGESKEITFPKMVANCCRFLCYFCRISRQNQKAMFDHLSYLLE
NSSVGLASPSMRGSTPLDVAAASVMDNNELALALREPDLEKVVRYLAGCGLQSCPLLISK
GYPDIGWNPVEGERYLDFLRFAVFCNGESVEENANVVVRLLIRRPECFGPALRGEGGNGL
LAAMEEAIQISEDPTRDGPSPNNGSSKTLEMEEQEDDTIHMGNAIMTFYAALIDLLGRCA
PEMHLIHAGKGEAIRIRSILRSLIPLEDLVGVISIPFHMPTIAKDGTVVEPDMSAGFCPD
HKAAMVLFLDRVYGIEDQDFLLHLLEVGFLPDLRAAASLDTAALSATDMALALNRYLCTA
VLPLLTRCAPLFAGTEHHASLIDSLLHTVYRLSKGCSLTKAQRDSIEECLLSICGQLRPS
MMQHLLRRLVFDVPLLNEHAKMPLKLLTNHYERCWKYYCLPGGWGNFGAASEEELHLSRK
LFWGIFDALSQKKYEQELFKLALPCLSAVAGALPPDYMESNYVNMMEKQSSMDSDGNFNP
QPVDTSNITIPEKLEYFINKYAEHSHDKWSMEKFANGWTYGETYSESAKVQPLMKQYKLL
SEKEKEIYRWPIKESLKTMLAWGWRIERTREGDSMALYNRTRRISQTSQISVDAAHGYSP
RAIDMSNVTLSRDVHAMAEMMAENYHNIWAKKKKMELEAKVGGGNHPLLVPYDTLTAKEK
AKDREKAQDILKFLQINGYVVSRGLKDLELDTPSIEKRFAYSFLQQLIRYVDEAHQYILE
FDGGSRGKGEHFPYEQEIKFFAKVVLPLIDQYFKNHRLYFLSAASRPLSTGGHASNKEKE
MVTSLFCKLGVLVRHRISLFGNDATSIVNCLHILGQTLDARTVMKTGLESVKMALRAFLD
NAAEDLEKTMENLKQGQFTHSRNQPKGVTQIINYTSVALLPVLSSLFEHIGQHQFGEDLI
LEDVQVSCYRILSSLYALGTSKSIYVERQRSALGECLAAFSGAFPVAFLETHLNKHNIYS
IYNTKNARDRAVLNLPTSVEEVCPNIPSLVKLMEEIVELAESGIRYTQMPHIMEVILPML
CSYMSHWWEHGPENNPDKVEVCCTALTSEHMNTLLGNILKIIYNNLGIDEGAWMKRLAVF
SQPIISKAKPQLLKTHFLPLMDKLKKKAAVVVSDEEHLRAEGRGDMSEAELLILDEFTTL
ARDLYAFYPLLIRFVDYNRAKWLKEPNPEAEELFRMVAEVFIYWSKSHNFKREEQNFVVQ
NEINNMSFLISDTKSKMSKAAVSDQERKKMKRKGDRYSMQTSLIVAALKRLLPIGLNICA
PGDQDLIALAKNRFSMKDTEDEVRDIIRSNLHLQGKLEDPAIRWQMALYKDLPNRTEDSS
DPEKTVERVLDIANVLFHLEQVEHPQRSKKAVWHKLLSKQRKRAVVACFRMAPLYNLPRH
RAVNLFLQGYDKSWIETEEHYFEDKLIEDLAKPGEEPQEEDESLKRVDPLHQLILLFSRT
ALTEKCKLEEDFLYMAYADIMAKSCHDEEDDDGEEEVKSFEVTGSQRSKHDNIKDLRNKF
ASLGENSLEKEMEKQKLLYQQARLHDRGAAEMVLQTISASKGEMGPMVAATLKLGIAILN
GGNSTVQQKMLDYLKDKKDVGFFQSLAGLMQSCSVLDLNAFERQNKAEGLGMVTEEGSVI
THERGEKVMQDDEFTCDLFRFLQLLCEGHNSDFQNYLRTQTGNNTTVNIIISTVDYLLRV
QESISDFYWYYSGKDVIDEQGQRNFSKAIQVAKQVFNTLTEYIQGPCTGNQQSLAHSRLW
DAVVGFLHVFAHMQMKLSQDSSQIELLKELMDLQKDMVVMLLSMLEGNVVNGTIGKQMVD
MLVESSNNVEMILKFFDMFLKLKDLTSSDAFKEYDPDGKGIISKRDFHKAMESHKHYTQS
ETEFLLSCAETDENETLDYEEFVKRFHEPAKDIGFNVAVLLTNLSEHMPHDTRLQTFLEL
SESVLNYFQPFLGRIEIMGSAKRIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGG
EKEKMELFVNFCEDTIFEMQLAAQISESDLNERSANKEDNEKDKLEEQDPGMGFFSLVTM
KSALVALKYNLMTLMKMLSVKSLKKQMKKVKKMTMKDMVMALFSSYWSILMGLLHFACSV
FRGFFRIICSLLLGGSLVEGAKKIKVAELLANMPDPTQDEVRGEGEEGERKPAETALPTE
DLTDLRTLSEESDLLSDIFGLDLKREGGQYKLIPHNPNAGLSDLLSTPSVAPMPEAQEKV
QDQVKEDEKEEKEETKSEPEKAEGEDGEKEEKAKEDRAKQKLRQLHTHRYGEPEIQESAF
WKKIIAYQQKLLNYFARNFYNMRMLALFVAFAINFILLFYKVSTSAVTEEKEIPVVSTGE
NMKLDSLESDSQRVIAVHYVLEESSGYMEPTLRILAILHTVISFFCIIGYYCLKVPLVIF
KREKEVARKLEFDGLYITEQPSEDDIKGQWDRLVINTQSFPNNYWDKFVKRKVMDKYGEF
YGRDRISELLGMDKAALDFSDAREKKKPKKDSSLSAVLNSIDVKYQMWKLGVVFTDNSFL
YLAWYMTMSVLGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYL
YTVVAFNFFRKFYNKSEDGDMPDMKCDDMLTCYMFHMYVGVRAGGGIGDEIEDPAGDEYE
IYRIIFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGNDYFDT
VPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWEFFPAGDCFRK
QYEDQLN
NT seq 14964 nt   +upstreamnt  +downstreamnt
atggccgaggggggcgaaggcgaggacgagattcagttcctgcgaactgatgatgaagtg
gttctgcagtgcactgcaactgttcacaaggagcaacagaaattgtgtcttgctgcggaa
ggatttggcaacaggctttgctttttggaatccacatcaaattctaagaatgtgccacct
gatttgtccatctgcacctttgtgcttgagcagtctctgtctgtacgagccctgcaggaa
atgctggctaacacagaggagaaggcagaagggctagttgatgtggaaaaatggaaattt
atgatgaagtctgcacaaggtggtggtcatcgaacacttctctatggacatgcaatcctg
ctgcgccattcctacagtggcatgtatctatgctgcctctcaacatctcgatcttcaatg
gataagctggcatttgatgtaggattgcaagaggacaccacaggtgaggcatgctggtgg
actatccatcctgcttctaagcagcgatcagaaggagaaaaagtgcgtgttggagatgac
cttattttagtcagtgtctcttctgaaagatacttgcatctctcctatggcaatggtagc
ttacatgttgatgcagctttccagcaaactctttggagtgtagcaccaatcagttcagga
agtgaatttgcccaaggatatctgataggtggggatgttctgaggttattgcatggtcac
atggatgaatgcttgacagtcccttcgggtgaacatggagaagaacaaagaagaaccgtc
cattatgaaggtggtgcagtgtcaattcatgctcgttccctttggcgattagaaactctg
agagttgcgtggagtggcagccacataagatggggacagccattcagactaagacatata
acaacaggaaaatacttaagtctcctagatgacaagagtcttcttcttactgacaaagag
aaagcagatataaaatctacagcattctgttttcggtcttccaaggaaaaattggatgta
ggtatgagaaaagaggtagatggaatgggaacacctgaaataaaatatggagattcaata
tgcttcatacagcatgtcgacacaggcttgtggctttcataccagtctgctgatgcaaag
tctgtaagaatgggttctgtgcaacgcaaggcaataatgcaccatgaaggtcacatggat
gatggtttaacattgtccagatctcagcatgaagaatcccgtacagcacgtgtcatccgt
agtacagtcttccttttcaacaggtttataaggggccttgatgctctcagcaaaaaagtg
aagtcttccacagtagatttacctattgagtcggtcagtctgagccttcaagacttgatt
ggctactttcacccccctgatgaacatttagagcatgaagacaaacaaaacaggctccgc
gcactgaagaatcgccagaacctcttccaggaagagggcatgatcaacctcgttcttgaa
tgtattgatcgcttgaatgtatacagcagtgcagctcattttgcagatgtagctgggaag
gaagctggagaagcatggaaatcgattctgaattccttgtatgaattactagcggctctt
attcgagggaatcgtaaaaactgtgctcaattttctggatctcttgattggctgatcagc
agattagaaagactagaagcctcttctggaatactagaagttctacactgtgtattggtg
gaaagccctgaagctctaaacattattaaggaaggacatattaaatcaatcatctgtctt
ttggacaaacatggaagaaaccataaggttttggatgtcttatgttctctctgtgtatgt
catggagtagctgtgcggtctaatcaacatctaatctgtgataatctcctgccaggaaga
gatctgctcttacagacccgccttgtgaaccatgtgagcagcatgcgacctaatattttc
ttgggaattagtgaaggctctgctcagtacagaaaatggtactatgaacttatggtggac
catctagagccttttgtgactgcagaatcaactcacctacgagtaggctgggcttcaaca
gagggctactcaccgtatccggggggaggagcagagtggggaggaaatggtgttggtgat
gacttgtattcttatggcttcgatggtctgcatctgtggtcaggctgtgtagctcgaaca
gtaaattctccaaaccaacatctgctgagaactgaagatgttattagttgctgtttggat
ctgagcgcccccagcatctcttttcggataaatggacagccagttcaaggaatgtttgag
aatttcaacatagatggccttttcttcccagttgtcagcttctctgcaggaataaaggta
cgtttcttgcttggaggtcgccatggagaattcaagttccttcctccacctggatatgcc
ccttgctttgaagctgttctaccaaaagagaaattgaaagtggagcatagccgagagtac
aagcaggatcgaaactatacaagggacctgctgggtcctactctcaatctgtcacaagca
gctttcacccccgttcctgtagatactagccagattgttttgcctccccacttggaacga
attagagaaaagttagcagagaacatccatgaactttgggttatgaataagattgaacta
ggctggcagtatggaccagttagagatgacaacaaaagacaacacccatgcttagtggag
ttctcaaaattgccggagcaggaaagaaattataacttacaaatgtcgcttgaaacactg
aaaacgctgctggcgttaggctgccatgttggaattgctgatgaacgtgctgaagaaaaa
gtgaaaaaaatgaaacttccaaagaactaccagttgttgagtggatataagcctgctccc
atggatctgagtttcatcaaactgaccccctctcaagaagctatggtggataaactagca
gagaatgctcacaatgtgtgggcaagggaccgaatcaggcaaggctggacctatggtatc
cagcaggatgtgaaaaatcgacgaaatcctcgtcttgtaccttatgcccttttggatgat
cgaacaaagaagtcaaataaagacagtcttcgggaagcagtccgcacccttctaggctat
ggctacaatctagaagctcctgaccaagatcatgccacaagagtggacatgagcaatggg
ataatggaaaaattccggatcttccgcacagagaaaacttatgcagtgaaatctggaaag
tggtacttcgagtttgaggcagttacagcaggagacatgagagttggctggacaaggcct
ggttgtctgccagatcaggaacttggctcagatgaagaagcttttgtttttgatggcttt
aaggcacagcggtggcatcaaggtaatgagcattttggccgctcatggttggcaggagat
gttgttggatgtatggttgacatgaatgaacacactatgatgttcaccttaaatggcgaa
atcctgcttgatgactcaggttcagaacttgcatttaaagattttgaggttggtgatgga
tttctacctgtgtgcagcctgggtccatctcaagtgggaagaatgaactttggaaaagat
gtcagcactctaaaatatttcactatctgtggcttacaggaagggtatgagccctttgct
gttaatacaaacagagacattaccatttggctcagtaaaaggctccctcagtttctacca
gtgccacaaaatcatgaacatattgaggtgatgagaattgatggaaccatagacacttgt
ccttgcctgaaggtcacacagaagtcctttggttcacagaacagtaaaacagatgtcatg
ttttttcgattaagtatgcccattgaatgtgctgaggtgttctccagaacagctgcagga
gggttaccaggcactggtctttttggcccgaagaatgatttggaagattatgatgctgat
tctgattttgaggttctaatgaaaactgctcatggtcatctagcagctgaccggacagag
agagaaaaagatgccacaaaaccggagttaaataaccataaagattatgttcaagaaaag
ccttcacgtcttaaacaaagatttatgcttaggaggacaaagccagattatagcacaagc
cattctgcaaggcttactgaggatgtgctagcagatgatagggatgactatgattatttg
atgcaaacttccacgtactattattcagtgagaatatttcctggtcaagaacctgctaat
gtttgggtaggctggattacatctgactttcatcagtatgacacaagctttgacttggac
agagtgcgtactgttacagtaactctgggagatgaaaaaggaaaggtccatgagagtata
aaacgcagcaactgctatatggtatgcgcaggagagagcatgagccctgggcaaggacgt
aataataatggtctggagattggttgcttagttgatgctgccagtggcctgctgaccttc
acagctaatggcaaagaactgggcacatactatcaggttgaaccaagcacaaagttattt
cctgctgtatttgctcaagctacaagccccaatgttttccagtttgagttgggtagaata
aagaatgtaatgccattatctgctggcttattcaaaagtgaacacaaaaatccagtttcc
cagtgtcctccacgtctccatgtccagtttctgactcacgtgctttggagtagagtgcca
aaccacttcttgaaagttgatgtctctaggatcagtgaacgtcaaggctggatgatacag
tgcctgaatcctttgcagttcatggcccttcacattcctgaagaaaacagaacaattgat
attttagagctgacagaacaagaagaactgctgaaatttcactaccatactctccgatta
tattcagctgtgtgtgctttaggaaacaaccgcgtggcccatgctatgtgtagccatgtg
gatgaatctcagcttctatatgctattgagaataaatatatgccaggactattacgtgca
ggatattatgacttactcatagacatccatctcaatacctatgcaactgccaggttaatg
atgaataatgaatttattgttccaatgactgatgagaccaagagtattaccctgtttcct
gatgaaaacaagaagcatggcctccctggtataggactcagcacttccttaaggccaaga
atgcagttctcctcaccgagttttgtaagcattaacagtgaatgctttcagttcagtcct
gaattcccactggaaatcttaaaggccaaaacaatagagatgctgactgaagcagttcag
gagggcagcctccatgtcagagacccagttggaggttctacagaatttctgtttgtccct
ctcatcaagctcttttacaccctcctaattatgggaatcttccacaatggggatctgaaa
cacatcttgcagttgattgagccacgggttttcaaagaagctgcgagtctggaggatgaa
aaggatctctcagagaaggagctgagttcagatgagctcaagtcaggagaggaagaaagc
agaggggagcaagtgccaaaggaaggactccttcagatgaagcttcccgaacctgttaag
ctacagatgtgtcatctactccagtacctgtgtgattgccaggtacgacaccggatagaa
gccattgtagcattttcggatgattttgtggccaagcttcaagagaatcagcgcttcagg
tacaatgaagtgatgcaggccttgaacatgtctgctgccttgacagctagaaaaacaaag
gaatttcgatccccacctcaggagcagattaacatgctgctgaactttaaagatgataaa
actgattgtccttgccctgaagaaattcgggatcaactcttggatttccatgaagaccta
atgacacactgtggaattgaactagatgaagatggaactttggatggaaatagtgattta
accattaggggtcgcctactatacttggtggaaaaagttacatatctgaagaagaagcaa
gctgagaagccagttgatgatgatgctaagacatcctctactcttcagcaattgatttca
gatacaatggtgcgctgggcccaggaatcagtaatagaagacccggagttagtcagggcc
atgtttgtactgctacatcgccaatatgatggtattggtggcttggttcgagccctgccg
aagacttacaccataaatagtgtgtccgtggaagatacaatcaatcttctggcatccctt
ggccaaattcgttccttgctcagtgtcaggatggggaaggaagaagagaaacttatgatt
cgtggattaggagacatcatgaataataaagtattttatcaacatcccaatctcatgaga
gctttaggcatgcacgagaccgtcatggaagtgatggtaaatgtacttggtggaggagaa
tccaaggaaatcactttcccaaaaatggtggcaaactgctgtcgtttcctatgttatttt
tgccgcattagtaggcagaatcaaaaagctatgtttgatcatcttagctatttattggaa
aatagcagtgttggccttgcctctccttctatgcgaggatctactcctttagatgttgca
gcagcatctgtgatggataacaacgaacttgcactagctttaagggagcctgatctggag
aaggtggttcgatacttggctggatgtggattgcagagttgtcctttgttgatttctaaa
ggctatccagacattggatggaatccagttgaaggagagcgatatttggattttcttcgt
tttgctgtattttgcaatggagagagtgtggaagagaatgcaaatgttgtagtgagactg
cttattcgtcgaccagaatgttttggtccggctctaagaggagaaggaggcaatggtcta
cttgctgccatggaggaagcaatacaaatatcagaagatccaacaagagacggaccttcc
ccaaataatggatctagtaaaacccttgaaatggaagaacaagaagatgacactattcat
atggggaatgcaatcatgacattttatgctgctttgattgatctcttaggacgttgtgcc
cctgaaatgcatctcatacatgctggtaaaggggaggccataagaatcaggtcaattcta
aggtctttgattccactggaagatttggtgggcgtaattagcattccgttccacatgccg
accatagctaaagatggtactgtggtggaacctgacatgtctgcggggttttgcccagat
cacaaggcagccatggttttgttccttgacagggtctatggaattgaggatcaggatttt
cttctacatcttcttgaagttggctttctgccagatctccgtgctgctgcttctttagat
acagctgctttgagtgctacagatatggctttagctctgaatcgatacctttgcacagca
gtcttgcctctgttgaccagatgtgctcctctttttgctggcacagagcaccatgcttcc
cttattgactccttattacatactgtgtacagactttcaaagggctgctctcttaccaaa
gctcagcgagattccattgaggagtgcttactttctatctgtgggcagttgagaccttct
atgatgcagcatttgctgagaagattagtatttgatgttcccctattaaatgaacatgca
aagatgcctctcaagttgctgacaaaccattatgaaagatgctggaagtattattgttta
ccaggtggatggggtaactttggtgctgcctcagaagaagaacttcatttatccagaaag
ttgttctggggtatttttgatgctttgtctcaaaagaagtatgaacaagaactattcaaa
ctggctttgccttgtttgagtgcagttgcaggggcattacctccagattatatggaatca
aattatgtcaatatgatggagaaacaatcttcaatggattcagatggaaactttaatcct
caacctgttgatacttcaaacattacaatccctgaaaagctggaatatttcattaacaaa
tatgcagaacattctcatgataaatggtcgatggaaaagtttgccaatggatggacgtat
ggtgaaacatactctgaatctgcaaaagtgcaaccattaatgaagcagtataaactactc
tctgaaaaggagaaagaaatttatcgatggccaatcaaagaatctctaaaaaccatgctg
gcatggggatggcggattgaaaggacacgggagggagattccatggcattgtataatcgg
acacgtcgcatatctcaaaccagtcaaatctctgtagatgcagcccatggttacagtcct
cgagcaattgatatgagcaatgttaccctctccagagatgtgcatgctatggcagagatg
atggctgaaaactatcataacatatgggcaaagaaaaagaaaatggagcttgaagcaaaa
gtaggaggaggcaaccatccccttcttgttccttatgatacactcacagccaaagaaaaa
gctaaggacagagaaaaagcacaggatattctgaaatttctacaaattaatggatacgta
gtctccagaggacttaaggacctggaattggacacaccttccattgagaaacgctttgcc
tacagtttcctccagcagcttataagatatgtagatgaagctcatcagtacattttggaa
tttgatggtggcagcagaggcaaaggagagcatttcccatatgaacaagaaatcaagttt
tttgccaaagttgtgctccctttgattgatcagtatttcaaaaatcatcgcttgtatttc
ttatctgcagcaagtaggcctctcagcactggaggccatgcctctaataaggagaaagaa
atggtgacaagcctgttctgcaaacttggagttcttgtcaggcataggatttcactgttt
ggaaatgatgcaacatcaatagtcaactgtcttcacatattgggccagaccttggatgcc
agaactgtgatgaaaactggtctggagtctgttaagatggcattgagagcatttttggac
aatgctgctgaggatctggagaaaacaatggaaaatcttaagcaaggccagtttacacac
agcagaaaccagcccaagggagttacacaaatcattaattatacctcagtggctctcctg
ccagtgctatcttcgttatttgagcatattggacagcaccagtttggggaagatttgata
ttggaagatgttcaagtgtcttgttatagaatattgtccagtttgtatgctctgggaacc
agcaaaagtatatatgtagagcggcaacgatcagcactaggagaatgcttggctgctttc
tcgggtgcctttccagtggcttttttggaaactcatttgaacaaacataatatctactca
atttacaataccaagaatgcaagagacagagcagttcttaatttacctactagtgtagaa
gaagtttgcccaaatattccttccttggtgaagctaatggaagaaattgtggaactggca
gaatctggtattcgctacacacaaatgccacatataatggaagtgatactgcctatgctg
tgtagttacatgtcacactggtgggagcatgggccagaaaacaatcctgacaaagttgaa
gtgtgttgtacagccttgacatcagagcacatgaacactctgttgggtaacatattgaaa
atcatctataacaaccttggtattgatgaaggagcctggatgaagaggttagcagtgttt
tcccagcccatcataagcaaagcgaagccacagctcttaaagacacacttcctgccactg
atggataagctaaagaaaaaagcagcagtggttgtatcggatgaagagcatctaagagca
gaaggcagaggtgacatgtcggaggctgaactgctcatcctagatgagttcaccactttg
gcacgggacctctatgccttctaccctttgttgattagatttgtggactataacagggca
aaatggctgaaagagcccaaccctgaagctgaagaattgttccgcatggtggctgaagtc
tttatttactggtcaaagtctcataatttcaaaagggaagagcagaactttgtggtacaa
aatgagatcaacaacatgtccttcctgatcagtgacaccaaatctaagatgtctaaggca
gcagtttctgaccaagagaggaagaagatgaagcggaaaggtgacaggtactctatgcag
acctctctcattgtggcagcgctgaagagattacttcctattggcctaaatatttgtgct
cctggagaccaagatctaattgcactggccaaaaaccgattcagcatgaaagatactgag
gatgaggtacgagatatcattcgcagtaatcttcatctccagggcaagctggaggatccc
gccattagatggcagatggcactttacaaagatttacctaacaggactgaagattcatca
gatccagagaagactgtggaaagagttcttgatatagctaatgtactgtttcatctggaa
caggttgaacatcctcagcggtccaaaaaagcagtttggcataagctgctgtctaaacag
aggaaaagagcagtagttgcttgctttagaatggcaccattgtataacctgccaaggcac
cgagctgtgaatctctttcttcaaggatatgataaatcttggattgaaacagaagaacac
tattttgaagacaaactgatagaagatttagcaaaacctggagaggaaccacaagaagaa
gatgaaagccttaaaagagtggatccattacatcaacttattctgctattcagtcgaaca
gccttaactgaaaaatgcaaattggaggaagattttctctatatggcttacgctgacatt
atggcaaagagttgccacgatgaagaagatgatgacggtgaagaagaagtaaagagcttt
gaagtcacaggatctcaacgcagcaagcacgataatatcaaagatttaagaaacaaattt
gccagcctcggcgagaactctctggaaaaagaaatggaaaagcaaaaacttctgtatcag
caagccagactgcatgaccggggtgctgctgagatggttcttcagacaatcagtgctagt
aaaggtgagatggggccaatggttgcagctaccctgaagctagggattgccatcttaaat
ggaggaaattctactgttcagcagaaaatgcttgactacctcaaggataagaaagatgtg
ggtttctttcagagtcttgctggtcttatgcagtcctgtagtgttcttgatctaaatgca
tttgaacgtcaaaacaaagcagaaggccttggcatggtgactgaagagggatcagtcatc
actcatgagcgcggagaaaaggtgatgcaggatgatgagttcacctgtgacctctttcgc
tttcttcaattgctttgtgaaggacacaattcagattttcagaattacttgagaactcag
actggtaacaacacaactgttaatattataatttccactgtggattacttattgagagtt
caggagtccattagtgatttctattggtattattctgggaaggatgttattgatgaacaa
ggacaacgaaatttttccaaagccatccaggttgcgaaacaagttttcaatactctgacg
gagtatatccaggggccatgtactgggaatcagcaaagtctggcacacagcaggctatgg
gatgctgtagttggttttcttcatgtatttgctcatatgcagatgaagctgtctcaggat
tccagtcaaattgaattactgaaagaattaatggatcttcagaaggatatggttgtcatg
ttgctgtctatgctggaaggtaatgttgtgaatggaactattggcaagcaaatggttgat
atgcttgtggaatcgtccaacaatgtggagatgattctgaagttttttgatatgttcttg
aaactgaaagatttgacttcttctgatgcgttcaaagagtatgatcctgatggtaaaggc
ataatttcaaaaagggatttccacaaggcaatggaaagccataagcattacacccagtct
gaaactgaatttctgctatcatgtgctgaaacagatgagaatgagactctggactatgag
gagtttgtgaaacgattccatgagcccgccaaagacattggtttcaatgtcgcggttctc
ctgaccaacctctccgaacacatgccccacgatactcgcttgcaaacttttcttgaactg
tcagaaagtgtgctgaattactttcagcctttccttggacgtatagaaatcatgggcagt
gcaaaacgcattgaacgagtgtattttgaaataagtgagtcaagtcggactcagtgggaa
aaacctcaggtaaaagagtcaaagagacagtttatatttgatgttgtaaatgaaggtgga
gagaaagaaaagatggagctttttgttaatttctgtgaagataccatctttgaaatgcaa
ctggctgcccaaatatccgagtcagatctaaatgaaaggtcagcaaataaagaggacaat
gagaaagataagcttgaggaacaggatcctggaatgggtttcttctcacttgtaactatg
aagtcagcattagtagcgctcaagtataatttaatgactcttatgaaaatgctcagcgtg
aagagcctaaagaaacagatgaagaaggtgaagaaaatgaccatgaaggacatggttatg
gctttattttcttcctactggagcattttaatgggtttactgcattttgcctgtagtgtc
ttccggggcttctttcgcatcatttgcagtttgcttcttggaggaagcctagtagaagga
gcaaagaaaatcaaggtggctgagctattagctaatatgccagatcccactcaggatgag
gtgcgtggggaaggagaagagggggagaggaagccagcagaaactgccttgcctactgaa
gacttgactgatttgagaactttatcagaggagagtgatctactctcagatatatttggt
ttggatttgaaacgagaaggtggacagtataaattgattcctcacaacccaaatgctggt
ttgagcgatttactgagcactccttctgtagcaccaatgcctgaggcacaggaaaaagtc
caggaccaggtgaaagaagatgaaaaggaagagaaggaagaaacaaaatctgaacctgaa
aaagcagaaggagaggatggagaaaaagaagagaaagcaaaggaagacagagcaaaacag
aagttaagacagcttcatactcacagatatggagaaccagaaattcaggaatcagctttc
tggaaaaaaattattgcatatcaacagaagcttcttaactattttgctcgaaacttttat
aacatgcggatgttggcgttgtttgttgcctttgccatcaacttcatcctgcttttctat
aaggtctccacctctgctgtgacagaagaaaaggaaattcctgtagtgtctactggagaa
aatatgaagttggacagcttggagagtgacagccagagggtcattgcagtgcactatgta
ctggaagaaagcagtggctacatggagcccacactgcgaattttggccatcttacacacg
gtcatctcattcttctgcatcattgggtattactgtttgaaagtcccactggtaattttt
aagagagaaaaggaagtagcaaggaagttggaatttgatgggctgtatatcactgaacag
ccctcagaagatgatattaaagggcaatgggatagacttgtaatcaacacacagtctttt
ccaaataactactgggacaaatttgtgaaaagaaaggtcatggataaatatggtgagttc
tatggccgtgacagaatcagtgagttactaggaatggacaaagctgctctcgatttcagt
gatgctagagaaaagaagaaaccaaagaaggatagctccttatctgctgtgctaaactcc
attgatgttaagtatcagatgtggaaattaggagttgttttcactgataattctttcctt
tacctagcttggtacatgaccatgtcagtccttggccattacaacaattttttctttgct
gctcatctccttgacattgcaatgggattcaagacattacgaactatactctcatcagtg
acccacaatggcaaacagcttgtcctaacagtgggattactggcagtagtggtatacttg
tacacagtagtggcattcaattttttccggaagttctacaacaaaagtgaagatggtgat
atgccagatatgaaatgcgatgatatgctaacatgctacatgtttcacatgtatgttgga
gtacgtgcaggtggaggtattggtgatgaaatagaggatccagcaggagatgaatatgaa
atctatcgaatcatctttgacatcactttcttcttctttgtgattgtcatcctgcttgcc
attattcaagggttaattattgatgcttttggtgagctaagagatcagcaagaacaagtg
aaggaagacatggagacaaagtgctttatctgtggaataggaaatgactactttgataca
gtgccccatggctttgaaactcatacactgcaggagcacaacttggccaattatttgttt
tttctgatgtatcttattaacaaagatgaaacggagcatacaggacaggaatcctatgta
tggaaaatgtatcaagaacgatgctgggagttttttcctgctggtgattgtttccgaaaa
cagtatgaagaccagcttaactaa

DBGET integrated database retrieval system