KEGG   Gallus gallus (chicken): 423298
Entry
423298            CDS       T01006                                 

Gene name
ACTC1
Definition
(RefSeq) actin, alpha cardiac muscle 1
  KO
K12314  actin, alpha cardiac muscle
Organism
gga  Gallus gallus (chicken)
Pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    423298 (ACTC1)
   04261 Adrenergic signaling in cardiomyocytes
    423298 (ACTC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gga04812]
    423298 (ACTC1)
   04147 Exosome [BR:gga04147]
    423298 (ACTC1)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     423298 (ACTC1)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   423298 (ACTC1)
  Exosomal proteins of bladder cancer cells
   423298 (ACTC1)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 423298
NCBI-ProteinID: NP_001072949
CGNC: 51944
Ensembl: ENSGALG00000009844
UniProt: P68034
Position
5
AA seq 377 aa
MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK
MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRL
DLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEK
SYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNV
LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS
KQEYDEAGPSIVHRKCF
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgtgtgacgacgaggagaccaccgcgctggtgtgcgacaacggctcggggctggtcaag
gcgggctttgctggggacgatgcccccagggctgtgttcccatccatcgtcggccgcccc
aggcaccagggtgttatggtcggtatgggtcaaaaggattcctatgtgggtgatgaagca
cagagcaaaagaggtatccttactttgaaatatcctattgaacatggcatcatcaccaac
tgggacgatatggaaaagatctggcaccacactttctacaatgaactccgtgtggcccct
gaggagcaccccaccttgctcacagaagcacctttgaaccctaaagctaatcgtgaaaag
atgacccagataatgtttgagaccttcaatgtacccgctatgtatgtggcaatccaggct
gtcctgtccctgtatgcctctggtcgtaccacaggtattgttcttgactctggtgatgga
gtcacccacaacgtgcccatttatgaaggttatgctttgcctcatgctatcatgcgtctg
gatctggctggcagggatctgaccgactacctcatgaagatcctcacagagcgtggctat
tcctttgtgaccacagctgaacgtgagattgttcgtgatatcaaagagaaattgtgctat
gttgcgctggactttgagaatgaaatggccacagctgcttcgtcatcctccctggagaag
agctatgaattgcctgatggtcaagtgatcacaattggtaatgaacgtttccgctgcccg
gaaaccttattccagccatcctttattggtatggaatctgctggtattcatgaaactacc
tacaacagcatcatgaagtgtgatattgatattcgtaaggatctgtatgctaacaacgtc
ctctcaggtggtacaacaatgtaccctggtattgctgatcgcatgcagaaagaaatcact
gcacttgctcctagcacaatgaagatcaagatcattgctccacctgaacgcaagtactct
gtctggattggtggctccattctagcatctttgtccaccttccagcaaatgtggatcagc
aaacaggagtatgatgaggctggtccatccattgtccaccgcaagtgcttctaa

KEGG   Gallus gallus (chicken): 426652
Entry
426652            CDS       T01006                                 

Gene name
ACTBL2L
Definition
(RefSeq) actin, alpha skeletal muscle B
  KO
K12314  actin, alpha cardiac muscle
Organism
gga  Gallus gallus (chicken)
Pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    426652 (ACTBL2L)
   04261 Adrenergic signaling in cardiomyocytes
    426652 (ACTBL2L)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gga04812]
    426652 (ACTBL2L)
   04147 Exosome [BR:gga04147]
    426652 (ACTBL2L)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     426652 (ACTBL2L)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   426652 (ACTBL2L)
  Exosomal proteins of bladder cancer cells
   426652 (ACTBL2L)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 426652
NCBI-ProteinID: XP_025006899
CGNC: 52851
Ensembl: ENSGALG00000040415
Position
5
AA seq 377 aa
MCDDDETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRIAPEEHPVLLTEAPLNPKANREK
MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRL
DLAGRDLTDYLMKILTERGYSFVTTAEREIVRDVKEKLCYVALDFENEMATAASSSSLEK
SYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNV
LSGGTTMYPGIGDRMQKEITALAPSTMKIKMIAPPERKYSVWIGGSILASLSTFQQMWIS
KDEYEESGPSIVHRKCF
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgtgtgatgatgatgaaaccactgcccttgtttgtgacaatgggtctgggctttgcaaa
gctgggtttgcaggagatgatgctccaagagctgtgtttccatccatcgttggacgccct
cgacatcagggtgttatggttggaatgggccaaaaagacagctatgtaggggatgaagcg
caaagcaaaagagggatcctgacgctgaagtatcccattgagcatggaatcatcaccaat
tgggacgacatggaaaagatttggcatcattctttctacaatgagctccgcattgcaccg
gaggagcatcctgtgctgctgactgaggccccattgaaccccaaggccaaccgcgaaaaa
atgactcagattatgtttgagacattcaatgtgccagccatgtatgtagcaattcaggca
gtgctgtctctgtatgcctctggaagaaccactgggatagttttggattctggggatggt
gtcacgcacaatgtacctatctatgagggctatgccttgccccatgctattatgaggctg
gaccttgcagggagagatctgactgactatctcatgaagatccttacagagagaggctat
tcttttgtcaccactgcggaacgggagattgtgagggatgtaaaggagaagctttgttat
gtggctttagattttgaaaatgaaatggcaactgctgcttcctcctcctcccttgaaaag
agctatgagcttcctgatggacaagtcatcacgattggaaatgaaagattccgatgccca
gaaactctcttccagccgtcctttatagggatggagtctgcaggtatccatgaaactacg
tacaacagcattatgaaatgtgatattgacatccgtaaggatctatatgccaacaatgta
ctctctggaggaaccacaatgtatcctggtattggtgaccgtatgcagaaagagatcaca
gctttggctccaagtaccatgaagattaagatgattgcaccaccagaacgtaaatactct
gtctggattgggggttcaatattggcatccctctccacttttcagcaaatgtggattagt
aaggatgaatacgaggaatctgggccctctattgtccatcgcaagtgcttttga

DBGET integrated database retrieval system