KEGG   Gallus gallus (chicken): 423408
Entry
423408            CDS       T01006                                 

Gene name
RPS6KA5
Definition
(RefSeq) ribosomal protein S6 kinase alpha-5
  KO
K04445  ribosomal protein S6 kinase alpha-5 [EC:2.7.11.1]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    423408 (RPS6KA5)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    423408 (RPS6KA5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    423408 (RPS6KA5)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     423408 (RPS6KA5)
Protein kinases [BR:gga01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   423408 (RPS6KA5)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Kdo APH Kinase-like Pkinase_fungal Pkinase_C RIO1 Haspin_kinase TCAD9 Choline_kinase SR-25
Other DBs
NCBI-GeneID: 423408
NCBI-ProteinID: NP_001012605
CGNC: 51959
Ensembl: ENSGALG00000030580
UniProt: Q5F3L1
Position
5
AA seq 789 aa
MEGPSGSAQGSEWPLLTVTHELRNANLTGHAEKVGIENFELLKVLGTGAYGKVFLVRKVS
GHDAGKLYAMKVLKKATIVQKAKTTEHTRTERQVLEHIRQSPFLVTLHYAFQTDTKLHLI
LDYINGGELFTHLSQRERFSENEVQIYIGEIVLALEHLHKLGIIYRDIKLENILLDSDGH
VVLTDFGLSKEFLTDENERAYSFCGTIEYMAPDIVRGGDTGHDKAVDWWSVGVLMYELLT
GASPFTVDGEKNSQAEISRRILKSEPPYPQEMSALSKDIIQRLLMKDPKKRLGCGPTDAD
EIKQHPFFQNINWDDLAAKKVPAPFKPVIRDELDVSNFAEEFTEMDPTYSPAATPQTSEK
IFQGYSFVAPSILFKRNAATVDPVQFYVGDERPGTTTIARSAMMKDSPFFQHYELDLKEK
PLGEGSFSICRKCLHKKTSQEYAVKIISKRMEANTQREITALKLCEGHPNVVKLHEVYHD
QLHTFLVMELLKGGELLERIQKKQHFSETEASHIMRRLVSAVSHMHDVGVVHRDLKPENL
LFTDETDNSEIKIIDFGFARLKPPDNQPLKTPCFTLHYAAPELFNHNGYDESCDLWSLGV
ILYTMLSGQVPFQSQDKSLTCTSALEIMKKIKKGEFSFEGEAWKNVSEEAKELIQGLLTV
DPNKRIKMSSLRYNEWLQDGSQLSSNPLMTPDNLGSSGAAVHTYVKATFHAFNKYKREGF
CLQNVDKAPLAKRRKMKKTSTSTETRSSSSESSHSSSSHSHGKTTPTKTLQPTNPTDSNN
PETIFQFSD
NT seq 2370 nt   +upstreamnt  +downstreamnt
atggagggcccctcgggctcggcgcagggcagcgagtggccgctgctcaccgtcacgcac
gagctgaggaacgcaaatttgacaggccatgcagagaaagttggcattgagaactttgaa
ctattgaaagtccttggaactggggcatatggaaaagtgttcctagtaaggaaagtaagc
ggccacgatgctggaaagctgtatgccatgaaagtactgaagaaagcaacaatagttcaa
aaagccaagacaactgagcacacaaggacagaacgacaagtattggaacacattaggcag
tcaccatttttggtcacgttgcattatgccttccagacagatacaaagcttcatctcatt
ttggactatataaatggaggagaactgttcactcatctttcacaaagagagagattctca
gaaaatgaggtgcaaatttacattggggaaattgttttggcacttgaacatctacacaag
ttgggaattatatatcgcgatataaaacttgagaatattctcctggattctgatggccac
gtggtgctgacagactttggtctgagtaaggagtttcttactgatgagaatgagagagca
tattctttctgtggaacaatagagtacatggctccagatattgtaagaggaggagataca
ggacatgataaggctgtcgattggtggagtgttggtgttcttatgtacgaattgctaact
ggagcatcaccctttacagttgatggagagaagaattctcaagctgagatttctaggaga
atattaaaaagtgagccaccttacccacaagaaatgagtgcactgtcaaaggatatcatt
cagcgccttttgatgaaagaccccaagaagagactaggttgtggtccaactgatgctgat
gaaatcaaacagcatccctttttccagaatataaattgggatgatttagctgccaaaaaa
gtgccagctccatttaaaccagtaatcagagatgagttggatgtcagtaactttgcagaa
gagtttacagaaatggacccaacatattctcctgcagcaacccctcagacttcagaaaaa
atatttcagggctattctttcgttgcaccttctattttgtttaaacgcaatgcagctaca
gtagatcctgttcagttttatgtgggggatgagcggcctggaactacaactattgccaga
agtgctatgatgaaggactctccattttttcaacattatgaactggatctgaaagagaaa
ccattgggagaaggaagtttttccatttgtcgaaagtgcttacacaagaaaactagccag
gagtatgcagtaaaaataattagcaaaaggatggaagcgaacacccagagagaaataaca
gctctgaaactctgcgaaggacaccccaacgtagtgaagttgcatgaagtttatcatgac
cagcttcacacttttctagtaatggaattactgaaaggaggagaattgcttgaacgtatt
cagaagaagcagcatttcagtgagacagaagccagtcatataatgcgcagacttgtttca
gcagtgagccacatgcatgatgtaggagtagtccatagagatctgaaacctgagaatttg
ttgtttacagatgaaactgataattcagaaataaaaatcattgattttggctttgctcgt
ttaaaaccacctgacaatcagcctcttaagactccatgttttactctgcattatgctgcc
ccagagctctttaatcacaatggttatgatgaatcctgtgatctctggagtttgggagtc
attctgtatacgatgttatcaggacaggtaccatttcaatctcaagacaaaagtttaaca
tgtacgagtgcattggaaattatgaaaaaaattaaaaagggagaattttcctttgaaggg
gaagcttggaaaaatgtttctgaagaggccaaggagttaattcaaggacttctgacagtg
gatccaaacaaaagaattaagatgtccagtctgagatacaacgaatggcttcaggatggc
agccagctgtcatctaaccctctaatgactcctgataacttgggttcttcaggtgctgca
gtgcatacatatgtcaaagccacctttcatgcctttaacaagtacaaaagggaaggattt
tgtctccagaatgttgacaaggcacctcttgcaaagagaaggaaaatgaaaaagacgagt
acaagcacagagacacgtagcagctccagtgaaagttcacattcttcttcctctcattct
catggtaaaactacacctacaaagacactgcagccaacaaaccccacagacagcaataac
ccagaaactatcttccagttctctgactga

DBGET integrated database retrieval system