KEGG   Gallus gallus (chicken): 424542
Entry
424542            CDS       T01006                                 

Gene name
PRKACB
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta isoform X7
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04020  Calcium signaling pathway
gga04114  Oocyte meiosis
gga04140  Autophagy - animal
gga04261  Adrenergic signaling in cardiomyocytes
gga04270  Vascular smooth muscle contraction
gga04310  Wnt signaling pathway
gga04340  Hedgehog signaling pathway
gga04371  Apelin signaling pathway
gga04530  Tight junction
gga04540  Gap junction
gga04910  Insulin signaling pathway
gga04912  GnRH signaling pathway
gga04914  Progesterone-mediated oocyte maturation
gga04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    424542 (PRKACB)
   04310 Wnt signaling pathway
    424542 (PRKACB)
   04340 Hedgehog signaling pathway
    424542 (PRKACB)
   04371 Apelin signaling pathway
    424542 (PRKACB)
   04020 Calcium signaling pathway
    424542 (PRKACB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    424542 (PRKACB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    424542 (PRKACB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    424542 (PRKACB)
   04540 Gap junction
    424542 (PRKACB)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    424542 (PRKACB)
   04912 GnRH signaling pathway
    424542 (PRKACB)
   04914 Progesterone-mediated oocyte maturation
    424542 (PRKACB)
   04916 Melanogenesis
    424542 (PRKACB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    424542 (PRKACB)
   04270 Vascular smooth muscle contraction
    424542 (PRKACB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    424542 (PRKACB)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:gga03019]
    424542 (PRKACB)
   03036 Chromosome and associated proteins [BR:gga03036]
    424542 (PRKACB)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     424542 (PRKACB)
Protein kinases [BR:gga01001]
 Serine/threonine kinases: AGC group
  PKA family
   424542 (PRKACB)
Messenger RNA biogenesis [BR:gga03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     424542 (PRKACB)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    424542 (PRKACB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like ABC1 Pkinase_C
Other DBs
NCBI-GeneID: 424542
NCBI-ProteinID: XP_004936715
CGNC: 66476
Ensembl: ENSGALG00000028530
UniProt: A0A1D5PLV3
Position
8
AA seq 338 aa
MNVKEFLAKAKEDFLRKWESPPQNTAGLDDFERQKTLGTGSFGRVMMVKHKATEQYYAMK
ILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEYSFKDNSNLYMVMEYVPGGEMFSHL
RRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVK
GRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVS
GKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKNHKWFATTDWIAIYQRKVEA
PFIPKCRGPGDTSNFDDYEEEDIRASLTEKCAKEFADF
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgaatgtgaaagagttcctagccaaagccaaagaagactttttaagaaaatgggaaagc
ccacctcagaatactgctggcctagatgattttgagaggcaaaaaactcttggaacagga
tcattcggaagagttatgatggtgaagcataaagccacagaacagtattatgccatgaag
atactggacaaacaaaaggttgtcaaactgaagcagatagaacacacactgaatgaaaag
agaatattacaagcagtgaactttcctttccttgtaaaactggagtattcttttaaggac
aattctaatttatacatggtaatggagtatgttcctggtggtgaaatgttctcacatcta
agaagaattggaaggttcagtgaaccacatgcacggttttatgcagctcagatagtgcta
acatttgagtacctccattcattagacctcatctacagagatctaaagcctgaaaatctt
ttaattgatcagcaaggatacatccaggtcacggactttggctttgcaaaaagagtaaaa
ggaagaacttggacgttatgtgggactccagaatacctggcacctgaaataattctcagc
aagggttacaacaaggcagtggattggtgggcattaggagtgttaatctacgaaatggca
gctggatatcccccattctttgcagatcaacccattcaaatttatgagaagattgtgtct
ggcaaggtaaggttcccatcacacttcagttcagacctaaaggatcttctaagaaattta
ctccaggtagatttgaccaaacgatatggaaatctcaagaatggtgtaaatgacataaaa
aaccacaagtggtttgcaactacagattggattgccatttatcagagaaaggtagaagct
ccattcataccaaagtgcagaggccctggagataccagcaactttgatgactatgaagaa
gaagatattcgtgcgtctctaacagaaaaatgtgcaaaagaatttgctgatttttag

DBGET integrated database retrieval system