KEGG   Gallus gallus (chicken): 426888
Entry
426888            CDS       T01006                                 

Gene name
RAPGEF3
Definition
(RefSeq) rap guanine nucleotide exchange factor 3 isoform X1
  KO
K08014  Rap guanine nucleotide exchange factor 3
Organism
gga  Gallus gallus (chicken)
Pathway
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    426888 (RAPGEF3)
SSDB
Motif
Pfam: RasGEF DEP cNMP_binding RasGEF_N
Other DBs
NCBI-GeneID: 426888
NCBI-ProteinID: XP_015155737
CGNC: 4776
Ensembl: ENSGALG00000043775
Position
33
AA seq 952 aa
MKVRGAGTATATGTGTGIGSGGEAERRGAAPVGTHCGRTGLERCPGAVPPPTPPPPPSPG
GSGGDGKRLSVLLKKMHLFRSSSYEIRLEGEGGSLPRIQGIRWTPLLDAESSLDYGHSLT
QASSEKIWRAGKLLFTYLTSTSPSLIRDHKHHLRHHRRCCSGKELVDWMLNAELGIQTRS
QAIGVGQVLVDGGVLTHVKQEWHFQDKDTQFYRFAELELSPEPRVGLRDAEELLEAVTFL
AQLGPDALLTMALRKPPAQRTEDELELIFEELLHIKAVAHLSNSVKRELASVLMFESHQR
AGTVLFSQGDKGTSWYIVWKGSVNVVTHGKGLVATLHEGDDFGQLALVNDAPRAASIILR
EDNCHFLRVDKQDFNRILKDVEANTMRLKEHGKVVLVLQKNLQGGSSQPAATRSSRYLVM
AGTPEKILEHLLEFMRLDATLYDPVDTLLGDFLLTYTVFMPTSQLCRALLHHFRAEPLDG
SEQEKATYCLHKRRKILRLVSQWVLLYGRLLQGDRSTTALLQSLADLASQDPRLGAMVQE
QERRRPRAMENGDGSISPQPKSRSSMSWLSSQDEAALSSSCALRAHDKVPYEVYRADHSC
LVTVLPVNASVRDVLQSLTPQLGWDGEHLLVKVNSAGDKVGLQLDAVGVFTSLGLNERLF
AVSVEELGGLTPHPEQLGPHVGSSDTLDLISSKDLASHLTDHDWNLFKSIHQVEMIHYIM
GPQKFHEVTTANLERMMRRFNELQYWVATELCLCPELGRRAQLLRKFIKLAAHLKEQKNL
NSFFAVMFGVSNTAVSRLAKTWERLPHKIRKLHAALERMLDPSWNHRVYRLAVAKLSPPI
IPFVPLLLKDMTFIHEGNRTLAENLINFEKMHMMAKTVRILQRCRGQAHAPLSPLRNRSP
HRPEDARAIRISTCSEQSLSVRSPVSTWAYLQHLRAIDSQKELLRLSRDLES
NT seq 2859 nt   +upstreamnt  +downstreamnt
atgaaggtgcgcggggccgggaccgccaccgccaccggaaccgggactgggatcggcagc
gggggggaggcggagcggcggggagcggctccggtggggacccattgcggacggaccggg
ctggagcgttgtcccggggctgtcccaccccccacgccgccgccgccgccgtcacccggt
ggttccggtggagacggtaagcggctgtcggtgctgctgaagaagatgcacttgttccgg
agctccagctacgagatcaggctggagggagagggggggagtctgccccgcatccagggc
atccgctggaccccgcttttggatgctgaatcctccctggactatggacacagccttacc
caggcatcctcggagaagatctggagagctggaaagctcctcttcacctacctcaccagc
accagccccagcctcatccgggaccacaagcatcacctgcggcaccacaggaggtgctgc
tccgggaaggagctggtggactggatgctgaatgcagagctgggcatccagacgcgaagc
caagccatcggcgtggggcaggtgctggtggacggcggggtcctgacgcacgtgaaacag
gagtggcatttccaggacaaggacacccagttctatcgctttgctgagttggagctgagc
cctgagccccgcgtggggctgcgggatgcggaggagctgctggaggcggtgaccttcctg
gcacagctggggcccgatgcgctgctcaccatggccctgcgcaaaccgcctgctcagcgc
acagaggacgagctggagctcatctttgaggagctgctccacattaaagccgtggctcac
ctctccaactcggtgaaacgggagctggcatctgtgctgatgttcgagtcgcaccagcga
gccggcaccgtgttgttcagccaaggggataaaggcacctcgtggtacatcgtctggaag
ggttcggtgaatgtggtcacccacggcaagggcttggtggccacattgcatgaaggggac
gactttgggcagctggcactggtgaacgatgctccccgagcagccagcatcatcctgagg
gaggacaactgccacttcctgcgggtggacaagcaggacttcaaccgcatcctcaaggac
gtggaagccaacaccatgcgcctgaaggagcacgggaaggtggtgttggtgctgcagaag
aacctgcagggaggcagcagccagccggccgccacgcggagcagcaggtacctggtgatg
gccgggacgccagagaagatcctggagcacctgctggagttcatgaggctcgatgccacg
ctctacgaccccgtggacacactcctaggggatttcctgctgacctacactgtgttcatg
ccgacctcgcagctctgcagggctctgctgcatcatttccgtgcggagccgctggatggc
tcagagcaggagaaagccacctactgcctgcacaagcgccgcaagatcctgcgcctggtg
agccagtgggtgctgctctatgggaggctgctgcagggcgaccgcagcaccacggctctg
ctgcagagcctcgccgacctggcgagccaggaccctcggctgggggccatggtgcaggag
caggagcggcggcggccccgagcgatggagaacggggacggcagcatttctccccagccc
aagtctcggagctccatgagctggctctccagccaagacgaggcagctttgagcagcagc
tgtgccttaagagcccacgataaagtgccctacgaggtctacagagccgaccattcgtgc
ctggtgacggtgctgcccgtcaacgcgtcggtgagggatgtgctgcagtccctcacccca
cagctgggctgggatggagagcacctcctggtgaaggtgaattcagccggagataaagtg
gggctgcagctggacgccgtgggggtgttcacctcgctgggcctcaacgagcggctcttt
gctgtcagcgtggaggagctgggaggtttgaccccccaccctgagcagctgggcccccac
gttggctcctcggacacgttggatctcatcagctccaaggacctggccagccacctcacc
gaccacgactggaacctcttcaagagcatccaccaggtggagatgatccactacatcatg
gggccacagaagttccacgaggtgacgacggccaacctggagcgaatgatgcggcgtttc
aatgagctgcagtactgggtggccaccgagctgtgcctctgccccgagctgggcaggaga
gcccaactgctgcgcaagttcatcaagctggctgcacacctcaaggagcagaagaatctg
aattccttcttcgcggtgatgtttggtgtgagcaacacagccgtgagccgccttgccaag
acctgggagaggctgccccacaagatccgtaagctgcacgcggcgctggagcggatgctg
gacccatcatggaaccaccgggtttatcgtctggccgtcgccaagctgagcccccccatc
atccccttcgtccccctcctccttaaagacatgaccttcatccacgaaggcaaccgcacg
ctggctgagaacctcatcaactttgagaagatgcacatgatggcgaagacggtgcgcatc
ctgcagcgctgccggggccaggcacacgctccgctgtccccgctgcggaatcgctcccca
caccgaccagaggatgccagggccatcaggatcagcacatgctcggagcagtcgctgagc
gtgcggagccccgtctccacctgggcatatctgcagcacctgagagccatcgacagccag
aaggagctgctgcggctctcccgtgatctggagtcctga

KEGG   Gallus gallus (chicken): 429022
Entry
429022            CDS       T01006                                 

Gene name
RAPGEF4
Definition
(RefSeq) rap guanine nucleotide exchange factor 4 isoform X4
  KO
K04351  Rap guanine nucleotide exchange factor 4
Organism
gga  Gallus gallus (chicken)
Pathway
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    429022 (RAPGEF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    429022 (RAPGEF4)
Membrane trafficking [BR:gga04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab associated proteins
    429022 (RAPGEF4)
SSDB
Motif
Pfam: RasGEF DEP cNMP_binding RasGEF_N RA
Other DBs
NCBI-GeneID: 429022
NCBI-ProteinID: XP_015145095
CGNC: 7114
Ensembl: ENSGALG00000043694
Position
7
AA seq 873 aa
MSGLLTPPYGVMETGSNNDRMPDKDSMSSGALCQVSKNCNKTPLIDSHIPHRPSKTITQV
PSEKILRAGKILRNTILSRAPHMIRDRKYHLKTYRQCCVGTELVDWMMQQSTCVHSRSQA
VGMWQVLLEEGVLNHVDQEHHFQDKYLFYRFLDDEREDAPLPTEEEKKECDEELQDTMLL
LSQIGPDAHMRMILRKPPGQRSIDDLEIIYEELLHIKALSHLSTTVKRELAGVLIFESHP
KAGTVLFNQGEEGTSWYIILKGSVNVVIYGKGVVCTLHEGDDFGKLALVNDAPRAASIVL
REDNCHFLRVDKEDFNRILRDVEANTVRLKEHDQDVLVLEKIPAGNRVSNQGSSQPQHKY
IVMSGTPEKILEHFLETMRLEATLNEATDSVLNDFIMMHCVFMPNSQLCPALMAHYHAQP
SQGTEQEKMDYALNNKRRVIRLVLQWAALYGDLLQEDEAAMAFLEEFYVSVSDDTRMIAA
LKEQLPELEKIVKQVAEEPKAPQKKHKVLLQLFNTSDDRAQKRQPIRGSDEVLFKVYCID
QTYTTIRVPVSSSVKEVISAVADKLGSGEGLIIVKMSSGGEKVVLKPHDVSVFTTLSVNG
RLFACPRDQFDSLAPLPEQEGPSAGTVGTFELMSSKDLAHQMTIYDWELFNCVHELELIY
HTFGRHNFKKTTANLDLFLRRFNEIQFWVVTEICLCSQLSKRVQLLKKYIKIAAHCKEYK
NLNSFFAIIMGLSNVAVSRLSLTWEKLPSKFKKIYAEFESLMDPSRNHRAYRLTVAKLDP
PIIPFMPLLIKDMTFTHEGNKTLTDNLVNFEKMRMIANTVRTVKFCRSQSFNPDAALANK
NHQDVRSYVRQLNVIDNQRTLSQMSHRLEPRRA
NT seq 2622 nt   +upstreamnt  +downstreamnt
atgtctggacttcttactcctccttatggtgttatggaaactggctccaacaatgacaga
atgccagataaggacagtatgtcaagcggtgctctttgccaagtttctaaaaattgtaat
aagacacctcttattgactctcacatcccacatcgtccctctaaaaccattacacaggtt
ccttcagaaaagatcctcagagctggaaagattttgcggaatacaattctgtcccgagcc
cctcacatgataagagatcgtaaatatcatctgaagacttacaggcagtgctgtgtgggg
acagaacttgttgactggatgatgcagcaaagtacttgtgtccattcacgaagtcaggct
gttggcatgtggcaagtattgctggaagaaggtgttcttaaccatgtggaccaggaacac
cactttcaggacaaatacttattttatcgatttttggatgatgagcgtgaagatgcccct
ttgccaacagaggaagagaaaaaggagtgtgatgaggagctacaggacactatgctgctt
ctgtcccagattgggccagatgctcatatgaggatgattctcagaaaaccgcctggccag
agaagtatagatgatttagaaattatatatgaagaacttcttcacattaaagccttatct
catctttctactacagtaaagagagaattagcaggtgtcctcatttttgagtcgcatccc
aaagctggaacagtcttatttaatcagggagaagaaggtacttcttggtacattatccta
aagggatcagtaaacgtagtcatttatggcaagggtgtggtatgtactctacacgaagga
gatgattttggcaagctagcacttgtgaatgatgctcccagagcagcatctattgttcta
cgtgaagacaactgccacttcttgagagtagacaaagaggacttcaacagaatccttagg
gacgtggaagcaaatactgtaagactcaaagaacatgaccaggatgtcttggtgttggag
aagatcccagcaggaaacagagtttctaatcaaggaagttcacagcctcagcacaaatac
attgtgatgtcaggaactccagagaaaattttagagcactttctagaaactatgcgcctt
gaagcaactttaaatgaagcaacagattctgttttaaatgattttattatgatgcactgt
gtttttatgccaaatagtcagctctgcccagccttgatggcacattatcatgcccagcct
tcccagggtacggagcaagagaaaatggattatgctctcaacaataaaaggcgagtcatt
cgactggttctgcagtgggctgctttgtatggagatttgctacaagaggatgaagcagca
atggcctttttggaggaattttatgtatctgtgtcagatgatactagaatgattgcagca
ctaaaggagcaacttccagagctagagaaaattgtaaagcaagtagctgaggaacctaaa
gcaccacaaaagaagcacaaagttctcctgcagctgtttaatacaagtgatgacagagca
cagaaacgccaacccatcaggggcagcgatgaagttctgtttaaggtgtactgcatagac
caaacctataccaccatccgcgtgccggtgtcttcgtctgtgaaggaagtgatcagcgca
gtagcagataagctgggttctggagaaggccttatcatagtaaagatgagttcaggagga
gaaaaagtcgtgctcaagcctcatgatgtttcagtgtttacaactctcagtgttaatgga
cggctctttgcttgcccgcgtgaccagtttgattcactggcaccgttaccggaacaagag
ggaccgtcagctggtacagttgggacgtttgaactgatgagctccaaagacctggcacat
cagatgacaatttacgactgggagctcttcaactgtgtgcatgagctggaactgatctat
cacacttttggaaggcataattttaaaaagaccacggcaaatctggatctatttttaaga
agatttaatgaaattcagttctgggtggtcactgagatttgtctttgctctcaactcagc
aagcgtgtgcagctattgaagaaatatattaagatagctgcccactgtaaagaatacaaa
aatctgaattcctttttcgctattattatgggactgagtaatgttgccgtgagccgtctg
tcactgacatgggagaaacttccaagcaagttcaagaagatctatgcagaatttgaaagc
ttaatggatccatcaagaaaccatagggcctacagactaactgtagctaaattggatcct
ccgataattcctttcatgcctctgcttataaaagacatgacgtttactcatgagggaaat
aagacactcactgacaatctagtaaacttcgaaaagatgcgcatgattgccaacactgtc
aggacggtgaagttctgccgaagtcaatccttcaatcctgacgcagccctagctaataag
aaccatcaggatgttcggagctatgtgaggcaattaaatgtgattgacaaccagagaact
ttatcacagatgtctcaccgactagagccgcgtcgggcataa

DBGET integrated database retrieval system