KEGG   Gallus gallus (chicken): 427262
Entry
427262            CDS       T01006                                 

Gene name
GNAQ
Definition
(RefSeq) guanine nucleotide-binding protein G(q) subunit alpha
  KO
K04634  guanine nucleotide-binding protein G(q) subunit alpha
Organism
gga  Gallus gallus (chicken)
Pathway
gga04020  Calcium signaling pathway
gga04261  Adrenergic signaling in cardiomyocytes
gga04270  Vascular smooth muscle contraction
gga04371  Apelin signaling pathway
gga04540  Gap junction
gga04912  GnRH signaling pathway
gga04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    427262 (GNAQ)
   04020 Calcium signaling pathway
    427262 (GNAQ)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    427262 (GNAQ)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    427262 (GNAQ)
   04916 Melanogenesis
    427262 (GNAQ)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    427262 (GNAQ)
   04270 Vascular smooth muscle contraction
    427262 (GNAQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    427262 (GNAQ)
   04031 GTP-binding proteins [BR:gga04031]
    427262 (GNAQ)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   427262 (GNAQ)
GTP-binding proteins [BR:gga04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    427262 (GNAQ)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA AAA_29
Other DBs
NCBI-GeneID: 427262
NCBI-ProteinID: NP_001026598
CGNC: 53032
Ensembl: ENSGALG00000015177
UniProt: Q5F3B5
Position
Z
AA seq 359 aa
MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK
VSTFENPYVDAIRSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRIADSTYLPTQQDVL
RVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQR
DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgactctggagtccatcatggcgtgctgcctgagcgaggaagccaaggaagcccggcgg
atcaacgacgagatcgagaggcagctgcgccgcgacaagcgggacgcgcgccgggagctg
aagctgctgctgctcggtacaggagagagtggcaaaagcacctttatcaagcagatgaga
atcattcatggatcaggttattccgatgaagacaaaaggggctttacaaaactggtgtac
cagaatatatttacagcaatgcaggccatgatcagagccatggatactctcaaaattcca
tacaagtatgaacataataaggctcatgctcagttagtgcgggaagtcgatgttgagaag
gtgtcaacttttgagaacccgtatgtagatgcaataagaagcttatggaatgacccagga
attcaggaatgttatgaccgacgacgggagtatcagttatcagattcaactaaatactat
cttaatgacttggaccgcatagcagattccacctatctgccaactcagcaagatgtgctt
agagttcgagttccaacaacaggaatcattgaatatccgtttgacttacaaagcgtcatt
ttcagaatggtggatgtaggaggccaacgatcagaaagaagaaaatggatacactgcttt
gaaaatgtcacatctatcatgttcctagtagctcttagtgaatatgatcaagtgcttgtg
gaatcagacaatgagaatcgaatggaagagagcaaggcactctttagaacaattatcaca
tatccgtggttccagaactcttcagtcattctgttcttaaataaaaaggatctcttagag
gagaaaattatgtactcccatctagttgattattttccggagtatgatggaccgcagcgg
gatgcacaggcggcccgagaattcatcctgaagatgttcgtagacctgaatccagacagt
gacaaaattatctactcccacttcacgtgcgctacagacacagagaatatccgcttcgtc
tttgctgctgtcaaggacacaatcctacagttaaacctgaaggagtacaacctggtctaa

DBGET integrated database retrieval system