KEGG   Gallus gallus (chicken): 427623
Entry
427623            CDS       T01006                                 

Gene name
ADRB2
Definition
(RefSeq) beta-2 adrenergic receptor
  KO
K04142  adrenergic receptor beta-2
Organism
gga  Gallus gallus (chicken)
Pathway
gga04020  Calcium signaling pathway
gga04080  Neuroactive ligand-receptor interaction
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    427623 (ADRB2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    427623 (ADRB2)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    427623 (ADRB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:gga04030]
    427623 (ADRB2)
G protein-coupled receptors [BR:gga04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    427623 (ADRB2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Other DBs
NCBI-GeneID: 427623
NCBI-ProteinID: XP_015149170
CGNC: 66534
UniProt: A0A1D5P7A9
Position
13
AA seq 402 aa
MGVAGTELPGGNVSANQSAADPTASRDVWVVGMGILMSLIVLVTVFGNVLVITAIARFQR
LQTVTNYFITSLACADLVMGLGVVPFGACHIIMEMWKFGNFWCEFWTSLDVLCVTASIET
LCVIAVDRYFAITSPFKYQSLLTKSKARVVILVVWAISALTSFLPIQMHWYRADRDEAIL
CYEKDTCCDFFTNQAYAIASSIISFYLPLVVMVFVYARVFQVAKKQLQKIDQSEGRFHIQ
NKEQDQNGKAGHRRSSKFFLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQDDIIPKY
VYILLNWLGYVNSAFNPLIYCRSPDFRYAFQELLCLRRSALKMYANGYSNSNGRSDYNEE
DNGYPLAPDKACELLCEEGSFPHPEDFLHCKEIPGCPGMVES
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgggggtggcgggcaccgagctgcctggcggcaacgtcagcgccaaccagagcgccgca
gaccccacggcgtcgcgggacgtgtgggtggtgggcatggggatcctcatgtcgctgatc
gtgctggtcactgtcttcggcaacgtgttggtgatcaccgccatcgcccgcttccagcgc
ctgcagacggtcaccaactacttcatcacctcgctggcgtgcgccgacctggtgatgggc
ctgggcgtggtgcccttcggtgcctgccacatcatcatggagatgtggaagtttgggaac
ttctggtgcgagttctggacctctctggacgtgctttgcgtcacggccagcatcgagacc
ctctgcgtcatcgctgtggaccgatactttgccatcacctccccgttcaagtaccagagc
ctgctgaccaagagcaaggcacgcgtggtcatcctggtggtgtgggcgatctcggccctc
acctccttcctgcccatccagatgcactggtaccgggcggaccgtgacgaggccattctc
tgctatgagaaggacacgtgctgtgacttcttcaccaaccaagcctatgccattgcctcc
tccatcatctccttctacctgcctcttgtggtcatggtatttgtgtacgccagggtcttc
caggtggccaagaagcagctgcagaagatagaccagagtgaggggaggtttcacatccag
aacaaggagcaggaccagaatgggaaagccgggcaccgccgttcctccaagttcttcctg
aaggagcacaaagctctgaagaccctgggcatcatcatgggcacctttacgttgtgctgg
ctgcccttcttcatcgttaacattgtgcacgtcatccaggacgacatcatccccaagtac
gtgtacatactcttgaactggctgggctacgtcaactctgccttcaaccccctgatctac
tgccgcagcccggacttcaggtacgccttccaggagctcctgtgcctccgcaggtctgct
ctgaagatgtatgccaacggctactcaaacagcaacggcaggagcgactacaacgaggag
gacaacggctaccccttggcaccagataaagcctgcgagctgctctgcgaagagggctcc
ttccctcaccccgaggactttttgcactgcaaagagatccctgggtgtccaggaatggtg
gagagctga

DBGET integrated database retrieval system