KEGG   Gallus gallus (chicken): 428597
Entry
428597            CDS       T01006                                 

Gene name
STX11
Definition
(RefSeq) syntaxin-11
  KO
K08487  syntaxin 11
Organism
gga  Gallus gallus (chicken)
Pathway
gga04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    428597 (STX11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    428597 (STX11)
Membrane trafficking [BR:gga04131]
 SNARE
  Syntaxin (Qa)
   Stx-PM
    428597 (STX11)
SSDB
Motif
Pfam: Syntaxin SNARE Herpes_BLRF2 Herpes_U30 MbeD_MobD DUF1217 Toprim_Crpt DivIC Spectrin
Other DBs
NCBI-GeneID: 428597
NCBI-ProteinID: XP_004935634
CGNC: 8871
Ensembl: ENSGALG00000011673
UniProt: E1BUT0
Position
3
AA seq 288 aa
MKDRLNEMRELARLHNQEFSYSEDDENSPRDILLYETDYALETLHKDIENIRTENNLLKE
DVKRLKKQNNRFLTSMRRLSSIKRDTNGIARDIKARGESIHRKLQIMRDFCEDAITKYGV
MSVIARVAKNHYVDLMHAFQEAMFEYNATEMNQRENCKIRIQRQLEIMGKDVSSNQIEEM
IEQGRWDVFSENLLSDVKGARSALNEIETRHKELVKLEGRIKEVHELFLQVALLVEEQAD
TFDVIEINVQNVEDYVGESKEQIKKALEYRRKHPLMTILCCCFSYCRR
NT seq 867 nt   +upstreamnt  +downstreamnt
atgaaagaccggctaaatgagatgcgtgaacttgccaggttgcacaaccaggagttttct
tacagtgaggatgatgaaaattcaccccgtgacattctcctttatgagactgattatgcc
ttggaaactcttcacaaggacatagagaacatccggactgaaaataacctcctaaaagag
gatgtcaagcgactaaaaaagcaaaacaaccgcttccttacttccatgcgtcgtcttagt
agcattaaacgagatactaatggtattgccagagacatcaaggcccgtggagaaagcatc
cacaggaaactccaaataatgagagatttctgcgaagatgcaataacaaaatatggggtg
atgtctgtcattgccagggtagcaaagaaccattatgttgaccttatgcatgcctttcag
gaagcaatgtttgaatacaatgcaacagagatgaaccaacgggagaactgcaagatccga
attcagcgtcagctagaaatcatgggtaaagatgtttctagcaaccagattgaggagatg
attgagcaaggcagatgggatgtcttctctgagaatctcttgtcggatgtgaagggagct
cgctcagccttgaacgagatagagacacgtcataaggagctggtgaaattagaaggtcgt
attaaggaggttcacgagctctttctgcaggtggccctgctagtggaagaacaggcagac
acctttgatgtcattgagataaatgtgcaaaatgttgaggactacgtaggagaatccaag
gagcaaattaaaaaagcattggaatacagaagaaaacaccctctcatgacaatcctctgc
tgctgcttttcgtattgcagaaggtga

KEGG   Gallus gallus (chicken): 770351
Entry
770351            CDS       T01006                                 

Gene name
STX19
Definition
(RefSeq) syntaxin-19
  KO
K08487  syntaxin 11
Organism
gga  Gallus gallus (chicken)
Pathway
gga04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    770351 (STX19)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    770351 (STX19)
Membrane trafficking [BR:gga04131]
 SNARE
  Syntaxin (Qa)
   Stx-PM
    770351 (STX19)
SSDB
Motif
Pfam: Syntaxin HAUS-augmin3 SNARE SKA2 Terminase_6C Hepcidin DUF5798 DUF5660 Glyco_hydro_77
Other DBs
NCBI-GeneID: 770351
NCBI-ProteinID: XP_015153418
CGNC: 11484
Ensembl: ENSGALG00000015413
UniProt: E1C6K1
Position
1
AA seq 291 aa
MRDRLQELKLRAKELQTAGENNCPPVQDEQEEIEQQAIIYEREPITERHFHEIQKLQNEI
NNLVEEVQKFSQQQKSLVSSMRRFSVLKKESNTAREIKIQAEHIRKGLDELSKTVKKVES
EYGISRAIVRILASQHTFLSRCYLNAMLSYNEAITAKQDKCRRFIVRQLEVAGKEVSEDE
VNDMFQQGKWEIFNENLLTEAKITKVQLSEIEQRHKELISLESQIKDLKELFIQISVLVE
EQGEMINNIEISMNNTQEYTQISREKFGLAVRYRKRHPCKVICCWCCPCCK
NT seq 876 nt   +upstreamnt  +downstreamnt
atgagagatcgcctccaggagcttaaactccgagccaaagaactacaaacagctggagaa
aataactgtccacctgtacaagacgagcaggaagagattgaacagcaggccattatttat
gaaagggagcctataaccgaaaggcacttccatgaaatccagaagcttcagaacgagatt
aataatttggtggaggaagttcaaaaattcagtcaacaacaaaaaagtctagtatcttca
atgagaaggttcagtgttcttaaaaaggaatctaacacagcaagagaaataaaaattcaa
gcagagcatatacgaaaaggtttggatgaactgtcaaaaacagtgaaaaaagttgaaagt
gaatatgggatttcacgtgccatagtaagaattctagcttcccagcacactttcctgtcc
cgctgttacctaaatgctatgctttcatacaatgaagctataacagccaagcaagataaa
tgcagaagatttattgttcgtcagcttgaagtagctggtaaagaggtatctgaggacgaa
gtcaatgatatgttccaacaaggaaaatgggagattttcaatgaaaatctactcactgaa
gccaaaattactaaagttcagctttcagagattgaacagagacacaaagaactgatcagc
ctagagagtcagatcaaagatctgaaggaactttttattcagatatcagttctggtggaa
gagcagggggagatgatcaacaacattgaaatcagtatgaacaacactcaggaatacacc
caaatatctagagaaaaatttggacttgcagtcaggtatcgaaaaagacacccttgcaaa
gtaatatgctgctggtgttgcccgtgctgcaagtga

DBGET integrated database retrieval system