Gordonia jinghuaiqii: H1R19_23030 Help Entry H1R19_23030       CDS       T07538                                  Symbol trxA Name (GenBank) thioredoxin   KO K03671   thioredoxin Organism gji  Gordonia jinghuaiqii Brite KEGG Orthology (KO) [BR:gji00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:gji03110]     H1R19_23030 (trxA) Chaperones and folding catalysts [BR:gji03110]  Protein folding catalysts   Protein disulfide isomerase    H1R19_23030 (trxA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 Thioredoxin_2 AhpC-TSA Thioredoxin_9 KaiB Redoxin OST3_OST6 Thioredoxin_7 TraF HyaE EKR Thioredoxin_3 Glrx-like Motif Other DBs NCBI-ProteinID:  QMT01639 UniProt:  A0A7D7LWL4 Position 5172454..5172792 Genome browser AA seq 112 aa AA seqDB search MGANTVAVNDTTFKDAVLGADKPVLVDFWATWCGPCRMVAPVLEEIARDHGDKLTVAKLD VDESPATARDFQIMSIPTMILFDKGQPVKTIVGAKGKAALLRELDSVVGQSA NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atgggtgccaataccgttgccgtcaacgacaccaccttcaaggacgccgtactcggcgcc gacaagccggtcctcgtggacttctgggccacctggtgcggtccctgccgcatggtcgcc ccggtcctcgaggagatcgcccgcgatcacggtgacaagctcaccgtcgccaaactcgat gtcgacgagagccccgcgaccgcccgtgacttccagatcatgtcgattccgacgatgatc ctgttcgacaagggtcagccggtcaagacgatcgtcggtgccaagggcaaggcggcgctg ctgcgcgagctcgattcggtggtcggccagtcggcctga

All links   Gene (1) NCBI-PROTEINID (1) Protein sequence (1) UniProt (1) Protein domain (14) Pfam (14) All databases (16) Download RDF

DBGET integrated database retrieval system