KEGG   Glycine max (soybean): 100101902
Entry
100101902         CDS       T01710                                 

Symbol
IF7GT
Name
(RefSeq) isoflavone 7-O-glucosyltransferase 1
  KO
K13263  isoflavone 7-O-glucosyltransferase [EC:2.4.1.170]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00943  Isoflavonoid biosynthesis
gmx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00943 Isoflavonoid biosynthesis
    100101902 (IF7GT)
Enzymes [BR:gmx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.170  isoflavone 7-O-glucosyltransferase
     100101902 (IF7GT)
SSDB
Motif
Pfam: UDPGT Cerato-platanin
Other DBs
NCBI-GeneID: 100101902
NCBI-ProteinID: NP_001235161
UniProt: A6BM07 A0A0R0G1T4
Position
16
AA seq 474 aa
MKDTIVLYPNLGRGHLVSMVELGKLILTHHPSLSITILILTPPTTPSTTTTTLACDSNAQ
YIATVTATTPSITFHRVPLAALPFNTPFLPPHLLSLELTRHSTQNIAVALQTLAKASNLK
AIVIDFMNFNDPKALTENLNNNVPTYFYYTSGASTLALLLYYPTIHPTLIEKKDTDQPLQ
IQIPGLSTITADDFPNECKDPLSYACQVFLQIAETMMGGAGIIVNTFEAIEEEAIRALSE
DATVPPPLFCVGPVISAPYGEEDKGCLSWLNLQPSQSVVLLCFGSMGRFSRAQLKEIAIG
LEKSEQRFLWVVRTELGGADDSAEELSLDELLPEGFLERTKEKGMVVRDWAPQAAILSHD
SVGGFVTHCGWNSVLEAVCEGVPMVAWPLYAEQKMNRMVMVKEMKVALAVNENKDGFVSS
TELGDRVRELMESDKGKEIRQRIFKMKMSAAEAMAEGGTSRASLDKLAKLWKQS
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgaaagacaccattgttctataccctaatcttggtaggggacacctagtttccatggtg
gagttgggaaaactcatactgacccaccacccttcactttccatcactattctcatcctc
actcctcccaccaccccttccaccaccaccaccaccttagcctgcgactctaatgctcaa
tacatcgccaccgtcaccgccaccactccctccatcacgttccaccgcgttcccctcgcc
gcactccccttcaacacccccttcctcccccctcacctcctctccctcgaactcacccgc
cacagcacgcaaaacatcgccgttgcactccaaaccctcgccaaagcttcgaacctcaaa
gccatcgtcattgacttcatgaacttcaacgaccccaaagccctcactgaaaatctcaac
aacaacgtccccacttacttctactacacttctggcgcctccactctcgctttactcctt
tactaccccaccattcacccaaccctcatagaaaaaaaggatacagaccaacctttgcaa
atccaaatccctggattatccacaattacagccgatgattttccaaacgaatgcaaagac
cccttgagttacgcttgccaagtcttccttcagatagcggaaaccatgatgggtggtgcc
gggattatagtaaacacatttgaagccattgaagaagaagccatcagagcgttaagtgag
gatgcgacagtaccaccacccttgttttgtgtcggacccgtgatttctgcaccgtatgga
gaagaagacaaagggtgtctgagttggctaaacttgcaaccgagtcagagcgtcgtgttg
ctgtgtttcggaagcatgggaaggttctcgagggctcagttgaaggagatagctattggg
ttggagaagagtgagcaaaggttcttgtgggttgtgagaaccgagttgggtggtgctgat
gactcggcggaggaactgagtctggacgagttgctgccagaagggtttttggagaggacc
aaggagaagggaatggtggtgagggactgggccccacaggcggcgattctgagtcacgac
tcggtgggtgggttcgtgactcactgcggttggaactcggtgttggaagcggtgtgtgaa
ggggtgccgatggtggcgtggcctctctacgcggagcagaagatgaacaggatggttatg
gtgaaggaaatgaaggtggctttggcggtgaacgagaacaaggatgggttcgtgagttcg
actgagttgggggaccgagttagggaactcatggaatcagacaaagggaaagagattcgt
cagaggattttcaagatgaaaatgagtgctgcggaagcaatggctgaaggcggaacatca
cgtgcttcgttggataagttggctaagctgtggaaacagagttga

DBGET integrated database retrieval system