KEGG   Glycine max (soybean): 100777343
Entry
100777343         CDS       T01710                                 

Symbol
UGT7
Name
(RefSeq) isoflavone 7-O-glucosyltransferase UGT7
  KO
K13263  isoflavone 7-O-glucosyltransferase [EC:2.4.1.170]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00943  Isoflavonoid biosynthesis
gmx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00943 Isoflavonoid biosynthesis
    100777343 (UGT7)
Enzymes [BR:gmx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.170  isoflavone 7-O-glucosyltransferase
     100777343 (UGT7)
SSDB
Motif
Pfam: UDPGT Cerato-platanin
Other DBs
NCBI-GeneID: 100777343
NCBI-ProteinID: NP_001304487
UniProt: I1MPF3
Position
16
AA seq 473 aa
MKDTIVLYPNLGRGHLVSMVELGKLILTHHPSLSITILILTPPTTPSTTTTLACNSNAQY
IATVTATTPSITFHRVPLAALPFNTPFLPPHLLSLELTRHSTQNIAVALQTLAKASNLKA
IVMDFMNFNDPKALTENLNNNVPTYFYYTSGASPLALLLYYPPINQVLIEKKDKDQPLQI
QIPGLPTITADDFPNECKDPLSYVCQVFLQIAETMMGGAGIIVNTFEAIEEEAIRALSED
ATVPPPLFCVGPVISAPYGEEDKGCLSWLNLQPSQSVVLLCFGSMGRFSRAQLKEIAIGL
EKSEQRFLWVVRTELGGADDSAEELSLDELLPEGFLERTKEKGMVVRDWAPQAAILSHDS
VGGFVTHCGWNSVLEAVCEGVPMVAWPLYAEQKMNRMVMVKEMKVALAVKENKDGFVSST
ELGDRVRELMESDKGKEIRQRIFKMKMSAAEAMAEGGTSRASLDKLAKLWKQS
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgaaagacaccattgttctataccctaatcttggtaggggacacctagtttccatggtg
gagttgggaaaactcatactgacccaccacccttcactttccatcactattctcatcctc
actcctcccaccaccccttccaccaccaccaccttagcctgcaactctaatgctcaatac
atcgccaccgtcaccgccaccactccctccatcacgttccaccgcgttcccctcgccgca
ctccccttcaacacccccttcctcccccctcacctcctctccctcgaactcacccgccac
agcacgcaaaacatcgccgttgcactccaaaccctcgccaaagcttcgaacctcaaagcc
atcgtcatggacttcatgaacttcaacgaccccaaagccctcactgaaaatctcaacaac
aacgtccccacttacttctactacacttccggcgcctcccctctcgctttactcctttac
tacccccccattaaccaagtccttatagaaaaaaaggacaaagaccaacctttgcaaatc
caaatccctggattacccacaattacagccgatgattttccaaacgaatgcaaagaccct
ttgagttacgtttgccaagtcttccttcagatagcggaaaccatgatgggtggtgccggg
attatagtaaacacatttgaagccattgaagaagaagccatcagagcgttaagtgaggat
gcgacagtaccaccacccttgttttgtgtcggacccgtgatttctgcaccgtatggagaa
gaagacaaagggtgtctgagttggctaaacttgcaaccgagtcagagcgtcgtgttgctg
tgtttcggaagcatgggaaggttctcgagggctcagttgaaggagatagctattgggttg
gagaagagtgagcaaaggttcttgtgggttgtgagaaccgagttgggtggtgctgatgac
tcggcggaggaactgagtctggacgagttgttgccagaagggtttttggagaggaccaag
gagaagggaatggtggtgagggactgggccccacaggcggcgattctgagtcacgactcg
gtgggtgggttcgtgactcactgcggttggaactcggtgttggaagcggtgtgtgaaggg
gtgccgatggtggcgtggcctctctacgcggagcagaagatgaacaggatggttatggtg
aaggaaatgaaggtggctttggcggtgaaagagaacaaggatgggttcgtgagttcgact
gagttgggggaccgagttagggaactcatggaatcagacaaagggaaagagattcgtcag
aggattttcaagatgaaaatgagtgctgcggaagcaatggctgaaggcggaacatcacgt
gcttcgttggataagttggctaagctgtggaaacagagttga

DBGET integrated database retrieval system