KEGG   Glycine max (soybean): 100789381
Entry
100789381         CDS       T01710                                 

Symbol
NES
Name
(RefSeq) nerol synthase
  KO
K24668  neryl diphosphate diphosphatase [EC:3.7.1.27]
Organism
gmx  Glycine max (soybean)
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100789381 (NES)
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.27  neryl diphosphate diphosphatase
     100789381 (NES)
SSDB
Motif
Pfam: Terpene_synth_C Terpene_syn_C_2 Terpene_synth
Other DBs
NCBI-GeneID: 100789381
NCBI-ProteinID: NP_001276223
UniProt: R4HEK6
Position
13
AA seq 534 aa
MDNIYIKQALVLKEVKHVFQKLIGEDPMESMYMVDTIQRLGIEHHFEEEIEAALQKQHLI
FSSHLSDFANNHKLCEVALPFRLLRQRGHYVLADVFDNLKSNKKEFREKHGEDVKGLISL
YEATQLGIEGEDSLDDAGYLCHQLLHAWLTRHEEHNEAMYVAKTLQHPLHYDLSRFRDDT
SILLNDFKTKREWECLEELAEINSSIVRFVNQNEITQVYKWWKDLGLNNEVKFARYQPLK
WYMWPMACFTDPRFSEQRIELTKPISLVYIIDDIFDVYGTLDQLTLFTDAIKRWELASTE
QLPDFMKMCLRVLYEITNDFAEKIYKKHGFNPIETLKRSWVRLLNAFLEEAHWLNSGHLP
RSAEYLNNGIVSTGVHVVLVHSFFLMDYSINNEIVAIVDNVPQIIHSVAKILRLSDDLEG
AKSEDQNGLDGSYIDCYMNEHQDVSAEDAQRHVAHLISCEWKRLNREILTQNQLPSSFTN
FCLNAARMVPLMYHYRSNPGLSTLQEHVKLLSNNAVAGAERHVVHILCLQFVIE
NT seq 1605 nt   +upstreamnt  +downstreamnt
atggataatatttatatcaaacaagcgttggtattgaaggaagttaagcatgtattccaa
aagcttattggcgaggatcccatggagagtatgtatatggttgacactatccaaaggctt
ggcattgaacaccacttcgaagaggaaattgaagctgctcttcagaagcaacatttgata
tttagcagtcatctcagtgattttgcgaataaccataaactttgtgaagttgcacttcca
ttccgtttacttagacaaagaggccattatgttcttgcagatgtatttgacaacctgaag
agtaacaaaaaagagtttagagaaaaacacggtgaagatgtgaagggtcttatttctctg
tatgaggcaacccagctaggtattgaaggagaagacagtcttgatgatgcaggttacctc
tgccaccaacttcttcatgcatggctgacaagacatgaagagcataatgaagctatgtat
gttgctaagactcttcagcatccgcttcattatgacttatcaagattcagggacgacaca
agtatacttctaaatgatttcaagaccaagagagaatgggaatgcttagaggaacttgct
gaaatcaattccagcatagttaggttcgtgaaccagaatgaaataactcaagtttacaaa
tggtggaaagaccttgggctgaacaatgaggtgaagttcgctagatatcaacctcttaaa
tggtacatgtggccaatggcatgcttcacagatccacgcttctcagagcaaaggattgag
ctcaccaaacctatctctctggtctacattattgatgacattttcgatgtttatgggaca
ttagaccagcttactttatttacagatgctattaaaagatgggaattggctagtacagag
caacttccagacttcatgaaaatgtgtttaagagttctttacgaaattaccaatgacttt
gccgaaaagatctacaagaagcatggattcaaccctatagagaccctgaaaagatcgtgg
gttcgattgttgaatgctttcttggaagaggcacattggttgaattctggtcatttgcca
aggtcagcggagtacttgaacaatggaattgtgagcacaggagtgcatgtggtgcttgtc
cattcattcttcctcatggattattctataaataacgaaattgttgctatcgtggacaac
gttccacaaattatacattcggtggctaaaattcttcgtctttctgatgatttggaagga
gctaagagtgaagatcaaaatggacttgatgggtcatacattgattgctacatgaatgaa
caccaagatgtttcagctgaagacgcccaaaggcatgttgcccacttaatttcatgtgaa
tggaaacgtctcaatcgagaaatcctcacccaaaatcaattgccatcatcatttaccaat
ttctgcctcaatgctgctagaatggtccctttgatgtaccattaccgtagcaatccaggc
ctctccactctacaagaacatgtcaagttactgtctaataatgctgtcgctggtgctgag
cgacatgtagtgcatattctatgcctgcaatttgttatcgaataa

DBGET integrated database retrieval system