KEGG   Glutamicibacter protophormiae: JQN66_03880
Entry
JQN66_03880       CDS       T07442                                 
Name
(GenBank) aldehyde dehydrogenase family protein
  KO
K20199  4-hydroxybenzaldehyde dehydrogenase (NADP+) [EC:1.2.1.96]
Organism
gpr  Glutamicibacter protophormiae
Pathway
gpr00623  Toluene degradation
gpr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gpr00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00623 Toluene degradation
    JQN66_03880
Enzymes [BR:gpr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.96  4-hydroxybenzaldehyde dehydrogenase (NADP+)
     JQN66_03880
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: QRQ79376
UniProt: A0A892ZCB4
Position
complement(804860..806350)
AA seq 496 aa
MTVQETERPAFLQKLPSALFINGQWIEGTSSSSLTTANPFDDTVLAEIRQASTADVDAAY
LAASEAQPAWAAMPPAARTAVLEKAAAYLQANYKDILALLSAESGSAQLKANIELSGTIA
AIREAATFPSRVFGKIMPSNFPGKENRVYREPLGVVAVISPWNFPMLLSARSVAPALALG
NAVVLKPASDTPLSGALILAKAFEEAGAPAGALNVLVGSGSEIGDYFVAHPTPSLVSFTG
STEVGQNVGKLAVSGEHMKRVALELGGNAPFVVLQNADLDEAVKAAALGKFLHQGQICMA
INRIIVQEPVYEEFVQKYAQLVSTLGFGDAAERKNLIGPVINDAQLASVTAKIERARTEG
AREVLSGAIQGRVIPPHVFADVTPQMELFREEIFGPVVGIAKADSEEHALELANDTRYGL
SSAVFTRDIEKGVRFARGIKAGMTHINDIPVNDEPHVMFGGEKNSGLGRFNGEWAIEEFT
TDHWVGVQSTPKKYPF
NT seq 1491 nt   +upstreamnt  +downstreamnt
atgaccgtgcaggaaaccgaacgcccagccttcctccagaagctgccctcagcgttgttc
atcaacggccagtggatcgaggggacgtcctcttcctcgctgaccactgccaatcccttt
gacgacacggtgctggccgagatccgccaggcctccaccgcagacgtggacgccgcctac
ctggccgcttccgaagcccagcccgcatgggcggcgatgcctcccgcggcccgcaccgcg
gtgctggagaaggccgccgcctacctccaggccaactacaaggacatcttggccctgctc
agcgccgagtccggttccgcgcagctgaaggccaacatcgagctcagcggcaccatcgcc
gcgatccgcgaagcggcgaccttcccgtcgcgcgtattcggaaagatcatgccttcgaat
ttccccggcaaggaaaaccgggtctaccgcgaaccgctgggagtggtcgcggtcatcagc
ccgtggaacttccccatgctgctttctgcccgctcggtggctccggccctggcgctgggc
aacgcggtggtgctcaagcccgcgtccgacaccccgctgtccggcgccctgatcctggcc
aaggccttcgaggaagccggagcaccggccggagcactgaacgtgctggttggttccggc
tcggaaatcggcgactacttcgtcgcccacccgacgccctcgctggtgtccttcaccggg
tccaccgaggtggggcagaatgtcggaaagctcgcagtgtccggtgagcacatgaagcgc
gtggccctggaactgggcggcaacgcgcccttcgtggtgcttcagaacgcggacctggat
gaagcggtgaaggccgcggcgctgggcaagttcctgcaccagggccagatctgcatggcg
atcaaccggatcatcgtccaggagccggtctacgaggaattcgttcagaaatatgcgcag
ctggtctccaccctgggcttcggcgatgccgccgagcgcaagaacctgatcggcccggtc
atcaacgacgcccagttggcctcggtcaccgccaagatcgagcgggcccggaccgaggga
gcccgcgaggtgctctccggggcgatccaggggcgcgtcatcccgccgcatgtctttgcg
gacgtgaccccgcagatggagctgttccgcgaggagatcttcggacccgtcgtgggcatc
gccaaggcggacagcgaagagcatgcgctcgagttggccaacgacacccggtacgggctg
tccagcgcggtgttcacccgcgacatcgagaagggcgtgcgcttcgcccgcgggatcaag
gccgggatgacgcacatcaacgacatcccggtgaacgacgagccgcatgtgatgttcggc
ggcgagaagaactcgggcctgggccgtttcaatggcgagtgggccattgaggaattcacc
accgaccattgggtgggtgtgcagagcacacccaagaagtacccgttctag

DBGET integrated database retrieval system