KEGG   Glycine soja (wild soybean): 114389415
Entry
114389415         CDS       T06057                                 

Name
(RefSeq) isoflavone 7-O-glucosyltransferase 1-like
  KO
K13263  isoflavone 7-O-glucosyltransferase [EC:2.4.1.170]
Organism
gsj  Glycine soja (wild soybean)
Pathway
gsj00943  Isoflavonoid biosynthesis
gsj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gsj00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00943 Isoflavonoid biosynthesis
    114389415
Enzymes [BR:gsj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.170  isoflavone 7-O-glucosyltransferase
     114389415
SSDB
Motif
Pfam: UDPGT Cerato-platanin
Other DBs
NCBI-GeneID: 114389415
NCBI-ProteinID: XP_028205885
Position
16
AA seq 473 aa
MKDTIVLYPNLGRGHLVSMVELGKLILTHHPSLSITILILTPPTTPSTTTTLACNSNAQY
IATVTATTPSITFHRVPLAALPFNTPFLPPHLLSLELTRHSTQNIAVALQTLAKASNLKA
IVMDFMNFNDPKALTENLNNNVPTYFYYTSGASPLALLLYYPPINQVLIEKKDKDQPLQI
QIPGLPTITADDFPNECKDPLSYVCQVFLQIAETMMGGAGIIVNTFEAIEEEAIRALSED
ATVPPPLFCVGPVISAPYGEEDKGCLSWLNLQPSQSVVLLCFGSMGRFSRAQLKEIAIGL
EKSEQRFLWVVRTELGGADDSAEELSLDELLPEGFLERTKEKGMVVRDWAPQAAILSHDS
VGGFVTHCGWNSVLEAVCEGVPMVAWPLYAEQKMNRMVMVKEMKVALAVKENKDGFVSST
ELGDRVRELMESDKGKEIRQRIFKMKMSAAEAMAEGGTSRASLDKLAKLWKQS
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgaaagacaccattgttctataccctaatcttggtaggggacacctagtttccatggtg
gagttgggaaaactcatactgacccaccacccttcactttccatcactattctcatcctc
actcctcccaccaccccttccaccaccaccaccttagcctgcaactctaatgctcaatac
atcgccaccgtcaccgccaccactccctccatcacgttccaccgcgttcccctcgccgca
ctccccttcaacacccccttcctcccccctcacctcctctccctcgaactcacccgccac
agcacgcaaaacatcgccgttgcactccaaaccctcgccaaagcttcgaacctcaaagcc
atcgtcatggacttcatgaacttcaacgaccccaaagccctcactgaaaatctcaacaac
aacgtccccacttacttctactacacttccggcgcctcccctctcgctttactcctttac
tacccccccattaaccaagtccttatagaaaaaaaggacaaagaccaacctttgcaaatc
caaatccctggattacccacaattacagccgatgattttccaaacgaatgcaaagaccct
ttgagttacgtttgccaagtcttccttcagatagcggaaaccatgatgggtggtgccggg
attatagtaaacacatttgaagccattgaagaagaagccatcagagcgttaagtgaggat
gcgacagtaccaccacccttgttttgtgtcggacccgtgatttctgcaccgtatggagaa
gaagacaaagggtgtctgagttggctaaacttgcaaccgagtcagagcgtcgtgttgctg
tgtttcggaagcatgggaaggttctcgagggctcagttgaaggagatagctattgggttg
gagaagagtgagcaaaggttcttgtgggttgtgagaaccgagttgggtggtgctgatgac
tcggcggaggaactgagtctggacgagttgttgccagaagggtttttggagaggaccaag
gagaagggaatggtggtgagggactgggccccacaggcggcgattctgagtcacgactcg
gtgggtgggttcgtgactcactgcggttggaactcggtgttggaagcggtgtgtgaaggg
gtgccgatggtggcgtggcctctctacgcggagcagaagatgaacaggatggttatggtg
aaggaaatgaaggtggctttggcggtgaaagagaacaaggatgggttcgtgagttcgact
gagttgggggaccgagttagggaactcatggaatcagacaaagggaaagagattcgtcag
aggattttcaagatgaaaatgagtgctgcggaagcaatggctgaaggcggaacatcacgt
gcttcgttggataagttggctaagctgtggaaacagagttga

DBGET integrated database retrieval system