KEGG   Glycine soja (wild soybean): 114390098
Entry
114390098         CDS       T06057                                 

Name
(RefSeq) isoflavone 7-O-glucosyltransferase 1-like
  KO
K13263  isoflavone 7-O-glucosyltransferase [EC:2.4.1.170]
Organism
gsj  Glycine soja (wild soybean)
Pathway
gsj00943  Isoflavonoid biosynthesis
gsj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gsj00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00943 Isoflavonoid biosynthesis
    114390098
Enzymes [BR:gsj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.170  isoflavone 7-O-glucosyltransferase
     114390098
SSDB
Motif
Pfam: UDPGT Cerato-platanin
Other DBs
NCBI-GeneID: 114390098
NCBI-ProteinID: XP_028206583
Position
16
AA seq 474 aa
MKDTIVLYPNVLRGHLVSMVELGKLILTHHPSLSITILILTPTTTSSTTSVSCNSNARYI
ATVTATTPAITFHHAPFATLPPSTPSLPSHILSIELTRHSTQNLAVALQTLAKASNLKAL
VIDFMNFNDPKALTENLNNNVPTYFYFASCASFLSLLLRLPTIHQTVTREKVKDQPLQIQ
IPGLPTISTDDFPNEAKDPSSESYQSLLQVAENMRCSVGIIANTFEALEEKSIRALCKDG
TLPPLFFIGPLISAPYEEDKGCLSWLDSQPSQSVVLLSFGSLGRFSRAQLKEIAIGLEKS
EQRFLWVVRSRLDDADSMEELSLDELMPEGFLERTKEKGLIMRNWAPQVQLLSHDSVGGF
VTHCGWNSVLEAVCEGVPMVAWPLYAEQKMNRVIMVKEMKVALEVNENKDGLVSATELGD
RVRELMDSVKGKEIRQRVFEMKKRAEEAMAEGGTSCVTLDKLAIKLWKGNMIDI
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgaaagacaccattgttctataccctaatgttctaaggggacacctagtttccatggtg
gagctaggcaaactcatactaactcaccacccttcactttccatcactatcctcatcctc
actccaaccaccacctcttccaccaccagcgtctcctgcaactctaatgctcgatacatc
gccaccgtcaccgccacgacccccgccatcacattccaccacgcccccttcgccacactc
cccccctccactccttccctcccctctcacatcctctccatcgaactcacccgccacagc
acgcaaaacctcgccgttgccctccaaaccctcgccaaagcctcgaacctcaaagccctc
gtcattgacttcatgaacttcaacgaccccaaagccctcactgaaaatctcaacaacaac
gtccccacttacttctacttcgcttcatgcgcgtcctttctctctctactccttcgttta
ccaaccattcaccaaaccgttactagagagaaggtcaaagaccaaccgctgcagattcaa
atccctggattacccacaatctccaccgacgattttccaaacgaggccaaagacccttcg
agtgaaagctaccagtccttgcttcaggtagcggaaaacatgaggtgcagtgttggcatt
atagcaaacacgtttgaagcccttgaagagaaatccatcagggcgttatgcaaagatggg
acgttgccgcctttgttttttatcggaccgttgatctctgcaccgtatgaagaagacaaa
gggtgcctgagttggctagactcgcaaccgagtcagagcgtcgtgttgctgagtttcgga
agcctcggaaggttttctagggctcagttgaaggagatagccattgggttggagaagagt
gagcaaaggttcttgtgggttgtgaggtccaggttggatgatgctgactcgatggaggaa
ctgagtctggacgagttgatgccagaagggtttctggagaggaccaaagagaaggggctg
ataatgagaaactgggccccacaggttcagttactgagtcatgactcggtgggtgggttc
gtgactcactgcgggtggaactcggtgttggaagcagtgtgtgaaggggtgccgatggtg
gcgtggcccctctacgcggagcagaagatgaatagggtgattatggtgaaggaaatgaag
gtggctttggaggtgaacgagaacaaagatgggttggtgagtgcaacagagttgggggac
cgagtcagggaactgatggactcggtaaagggaaaagagattagacaaagggttttcgag
atgaaaaaaagggctgaggaagcaatggctgaaggtggaacctcgtgcgtcacgttagat
aagttggctatcaagttgtggaaaggaaacatgattgacatctaa

DBGET integrated database retrieval system