Halomonas sp. A3H3: HALA3H3_30270 Help Entry HALA3H3_30270     CDS       T10226                                  Name (GenBank) putative enzyme   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism haah  Halomonas sp. A3H3 Pathway haah00362   Benzoate degradation haah00621   Dioxin degradation haah00622   Xylene degradation haah01100   Metabolic pathways haah01120   Microbial metabolism in diverse environments haah01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:haah00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     HALA3H3_30270    00622 Xylene degradation     HALA3H3_30270    00621 Dioxin degradation     HALA3H3_30270 Enzymes [BR:haah01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      HALA3H3_30270 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 Motif Other DBs NCBI-ProteinID:  CDG52053 Position hala3h3:complement(334709..334897) Genome browser AA seq 62 aa AA seqDB search MPIVTVQQSPGRTKEQRELLVKRITEAFSEAYGTSPEAVTIFLQNFDDEHWAKGGKLHSD RS NT seq 189 nt NT seq  +upstreamnt  +downstreamnt atgccaatcgtaaccgttcagcagtctccaggcaggactaaagagcaacgtgagctctta gttaagcgtataaccgaagcattttcagaagcatatggaaccagccctgaggcagtaaca atcttccttcaaaattttgatgatgagcattgggccaaaggtgggaagctacattctgat cgttcctga

All links   Gene (1) NCBI-PROTEINID (1) Protein domain (2) Pfam (2) All databases (3) Download RDF

DBGET integrated database retrieval system