KEGG   Hypericibacter adhaerens: FRZ61_44250
Entry
FRZ61_44250       CDS       T06413                                 

Definition
(GenBank) 2-hydroxychromene-2-carboxylate isomerase
  KO
K14584  2-hydroxychromene-2-carboxylate isomerase [EC:5.99.1.4]
Organism
hadh  Hypericibacter adhaerens
Pathway
hadh00626  Naphthalene degradation
hadh01100  Metabolic pathways
hadh01120  Microbial metabolism in diverse environments
hadh01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hadh00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    FRZ61_44250
Enzymes [BR:hadh01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.4  2-hydroxychromene-2-carboxylate isomerase
     FRZ61_44250
SSDB
Motif
Pfam: DSBA Thioredoxin_4 Thioredoxin_5
Other DBs
NCBI-ProteinID: QEX24484
UniProt: A0A5J6N4W9
Position
4925587..4926192
AA seq 201 aa
MPPTIDFYFSIDSRYSYLAATQIPVLEREFGATVNWRPLGLSALLAARGATPFSTGLRVS
GQYEHDYRDIDTRRWAEFYGVKITTPDWRQGDWDRINLAAVAAAVEGRCRAFVTALYDAV
MVQGAVPKDDAALARIAGQAGLDGTRLVAGIDAPATAALHRATIEQARQAGVFGVPSFVT
GGEMFWGNDRILLLKRRLCVH
NT seq 606 nt   +upstreamnt  +downstreamnt
atgccaccgaccatcgacttctatttctcgatcgacagccgctactcctacctggcggcg
acgcagattccggtgctggagcgcgagttcggcgccaccgtcaactggcgcccgctggga
ctgtcggcgctgctggccgcgcgcggcgcgacgcccttcagcaccggccttcgggtttcc
ggccagtacgagcatgactatcgcgacatcgacacgcgccgctgggccgaattctatggc
gtgaagatcacgacgccggactggcgccagggcgattgggatcgcatcaacctggcggcc
gtcgccgccgccgtcgaaggacgctgccgcgccttcgtgacggcgctctatgatgcggtc
atggtgcagggcgcggtgcccaaggacgacgcggcgctcgcccgcatcgcgggccaagcg
ggcctcgacggcacccgcctcgtcgccggcatcgacgcgccggccacggcggcactgcac
cgcgccaccatcgagcaggcccgccaagccggcgtcttcggcgtgccgagcttcgtcacc
ggcggcgagatgttctgggggaatgaccggattctactgctgaaacgccggctttgcgtc
cactga

DBGET integrated database retrieval system