KEGG   Hypericibacter adhaerens: FRZ61_48030
Entry
FRZ61_48030       CDS       T06413                                 

Symbol
gor
Name
(GenBank) glutathione-disulfide reductase
  KO
K22364  2-oxopropyl-CoM reductase (carboxylating) [EC:1.8.1.5]
Organism
hadh  Hypericibacter adhaerens
Brite
KEGG Orthology (KO) [BR:hadh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FRZ61_48030 (gor)
Enzymes [BR:hadh01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.5  2-oxopropyl-CoM reductase (carboxylating)
     FRZ61_48030 (gor)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 HI0933_like
Other DBs
NCBI-ProteinID: QEX24861
UniProt: A0A5J6N4V3
Position
complement(5345484..5347064)
AA seq 526 aa
MMDGGTIWDARNTSLTIDQWAVKIEEALEQAGRSEAIFNVDPNDNREFDTIFIGGGAAGR
FGSAYLRAMGGRQLVIDRWPFLGGSCPHNACVPHHVFSECAAELMLARTFSGRFWFPKMD
GVTVNMKEIVDLFRRGRTGPHAVMNYQSKEQLDIEFVLNAPARIIDAHTVEVAGRRFKAR
TLVLGLGARPQRLAVPGVDLKGVYDYTSFVETLDYEPGNTAVVVGGSKTAVEYGCFFNAT
GRRTVMLVRSQLLKLIPDADTRTYVIDRMRDQGIEIIEGAEVVRIEGDSRGRVAKLVAKT
PNGPLEIKTDFVFLGLGETPNSEAAVEALGVKTDPKTGAVLVDDSLRTSVPNVYAVGDLI
GAPMEMFKARKSGTYAARAIMGQAISYRPTDWPDFLHTHYEVTWLGLGEDEARKRYRNVV
VIRMPPHNPNGLDIGLPASDRVMLYAMAKPRMSGFQKLVIDGDSRRIVGAHHVGYGARDA
FQYLYVLVKQGLTIDQLGDMDELFLNPTHFIQLSRLRAGQKELRDL
NT seq 1581 nt   +upstreamnt  +downstreamnt
atgatggacggcggaacgatctgggatgcccgcaacacctccctgaccatcgaccaatgg
gcggtgaagatcgaggaggcgctggagcaggccggtcgctcggaagcgatcttcaacgtc
gatccgaacgacaaccgggagttcgacacgatcttcatcggcggcggcgccgccgggcgt
ttcggctcggcctatctgcgcgcgatgggcggccgtcagctcgtgatcgaccgctggccc
ttcctcggcggttcctgcccccacaacgcctgcgtgccgcatcacgtgttctccgaatgc
gcggccgagctgatgctcgcgcgcaccttcagcggccggttctggttcccgaagatggac
ggcgtcacggtcaacatgaaggagatcgtcgacctgttccggcgcgggcggacgggcccc
cacgccgtcatgaactatcagagcaaggagcagctcgacatcgagttcgtcctgaacgcg
ccggcgcgcatcatcgatgcgcacacggtcgaggtggcggggcggcgcttcaaggcgcgc
acgctggtgctcggcctcggcgcccggccccagcgcctggcggtgcccggcgtcgatctc
aagggcgtctatgactacaccagcttcgtcgagacgctcgactatgagccgggcaacacg
gccgtggtggtgggcggcagcaagacggcggtcgaatatggctgcttcttcaacgccacc
ggccggcgcaccgtgatgctggtgcgcagccagctcctgaagctgatcccggacgccgac
acgcgcacctatgtcatcgaccggatgcgcgaccagggcatcgagatcatcgagggcgcc
gaggtcgtcaggatcgagggcgattcccgcggccgtgtcgccaagctggtggccaagacg
ccgaacggcccgctcgagatcaagacggatttcgtcttcctcgggctgggcgagacgccg
aattccgaggccgcggtcgaggcgctcggcgtcaagaccgatcccaagaccggcgccgtc
ctggtcgatgacagcctccggacctcggtgccgaacgtctatgccgtgggcgacctgatc
ggtgcgcccatggagatgttcaaggcgcgcaagagcggcacctacgcggcgcgcgccatc
atgggccaggcgatctcctaccggcccaccgactggccggatttcctccatacgcattac
gaggtgacctggctcggcctcggcgaggacgaggcgcgcaagcgctaccgcaacgtcgtc
gtgatccgcatgccaccgcacaatcccaacggtctcgatatcgggctcccggcttccgac
cgcgtcatgctctatgcgatggccaagccccgcatgtcgggcttccagaagctggtgatc
gacggcgacagccggcgcatcgtgggcgcccatcacgtgggctacggcgcaagggatgcc
ttccagtatctctatgtgctggtgaagcagggcctgaccatcgaccagctcggcgacatg
gacgagctgttcctcaacccgacccacttcatccagctctcgcgcctgcgcgcgggccag
aaggagctgcgcgacctatga

DBGET integrated database retrieval system