Halolamina sp. CBA1230: B4589_013315 Help Entry B4589_013315      CDS       T06651                                  Name (GenBank) NUDIX hydrolase   KO K03574   8-oxo-dGTP diphosphatase [EC:3.6.1.55] Organism haln  Halolamina sp. CBA1230 Brite KEGG Orthology (KO) [BR:haln00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:haln03400]     B4589_013315 Enzymes [BR:haln01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.55  8-oxo-dGTP diphosphatase      B4589_013315 DNA repair and recombination proteins [BR:haln03400]  Eukaryotic type   Other factors with a suspected DNA repair function    Modulation of nucleotide pools     B4589_013315  Prokaryotic type     B4589_013315 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NUDIX NUDIX_2 Motif Other DBs NCBI-ProteinID:  QKY21303 UniProt:  A0A7D5BZH5 Position complement(2520834..2521223) Genome browser AA seq 129 aa AA seqDB search MTHQFAVTQKAVLLGPEPEQRLLLLENENGVWELPGGQLRVGEQPIPGLKRAIRETTGLD IDVDGPVLNTAWEIDGGGAFASIYRAHSPTESATLSGDHVRAVWLAPEEAVERDLNSTQK RAIERTGLR NT seq 390 nt NT seq  +upstreamnt  +downstreamnt gtgacccaccagttcgcagtcacgcagaaggcggtgctgctcggccccgaacccgagcag cggctgctgttgctggagaacgagaacggcgtctgggagctccccggcgggcagcttcgc gtgggcgagcagccgatcccggggctgaaacgcgcgatccgggagacgaccgggctcgac atcgacgtcgacgggcccgtgctgaacacggcctgggagatcgacgggggcggcgcgttc gcgtcgatctaccgcgcccacagcccgaccgagagcgcgacgctttcgggcgatcacgtc cgggcggtgtggctcgcccccgaggaggccgtcgaacgcgacctgaacagcacccagaaa cgtgcgatcgagcggacggggctgcgctga

All links   Gene (1) NCBI-PROTEINID (1) Protein sequence (1) UniProt (1) Protein domain (2) Pfam (2) All databases (4) Download RDF

DBGET integrated database retrieval system