KEGG   Ruania alkalisoli: IM660_06185
Entry
IM660_06185       CDS       T06878                                 

Name
(GenBank) glycoside hydrolase family 15
  KO
K22308  isomaltose glucohydrolase [EC:3.2.1.205]
Organism
halt  Ruania alkalisoli
Brite
KEGG Orthology (KO) [BR:halt00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    IM660_06185
Enzymes [BR:halt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.205  isomaltose glucohydrolase
     IM660_06185
SSDB
Motif
Pfam: Glyco_hydro_15
Other DBs
NCBI-ProteinID: QOR71851
UniProt: A0A7M1SWJ1
Position
complement(1455874..1456977)
AA seq 367 aa
MTTTAHAPLLETSRDLITSLQEPSGAYPASPTFSAYRGYCWFRDGAFIADGVSSTGEVAS
PSAFLDWCARVVKAHRTPIERVVAADAAGEPVPQEQMLPTRFTMAGTPGADEWWDFQLDG
YGTWLWAAAEHAARHGLDVTRWRSAAELTVDYLLSSWQRPCYDWWEEHAEQVHVSTLGCI
VAGLRAAADSGLVTGTRADAARDGAKAAMDVITSRGVAHGHLTKWLGTDAVDASLAALIG
PLGVIEPESELAAATIAAIEEQLCTDGGVYRFRADTFYGGGRWPLLSCFLGLAHARAGNT
ARAGELLDWAAGTATTDGLLPEQVDGHLLAPHYRTEWIDRWGPVATPLLWSHAMVLRLAA
ELKEENT
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgaccaccactgcccatgccccgctgctggagacgtcccgcgacctcatcacctccctg
caggaaccgagcggcgcctacccggcaagccccacgttctccgcctaccgcgggtactgc
tggttccgggacggagcgttcatcgccgacggcgtctcttccaccggggaggtcgcctca
ccttcggcgttcctggactggtgcgcccgggtggtcaaggcccatcgcacgccgatcgag
cgggtggtcgcggccgacgcggccggtgagccggtgccgcaggagcagatgctgccgacg
cgcttcacgatggccggcacccccggggcagacgaatggtgggacttccagctcgacggg
tacggcacctggctgtgggccgccgccgagcacgccgcacggcacggactcgacgtcacg
cggtggcggtcggctgccgaactcaccgtggactacctactcagctcgtggcagcggccc
tgctacgactggtgggaggagcacgccgagcaggtgcacgtctccaccctggggtgcatc
gtggccggcctgcgcgcggctgccgactcgggcctggtgactggcacacgggctgatgct
gctcgcgatggggcgaaggcggccatggacgtgatcaccagccgcggggtcgcccacggg
cacctgaccaagtggctcggcaccgacgccgtggacgccagtctggcagcgctgatcggt
ccgctcggggtgatcgagccggagtccgagctcgccgcggccacgatcgccgcgatcgag
gagcagctgtgcaccgacggcggtgtgtaccgcttccgggccgacaccttttacggcggc
ggccggtggccgttgctgtcctgcttcctcggcctcgcgcacgcacgcgccgggaacacc
gcacgggctggcgagctgctcgactgggcggccggcaccgcgacaacggacggcctgtta
cccgagcaggtggacgggcacctgctcgcaccgcactaccgcaccgaatggatcgaccgc
tggggaccggtggcaacaccgctgctgtggtcccacgcgatggtgcttcgcctggcggcg
gagctgaaggaggagaacacatga

DBGET integrated database retrieval system