KEGG   Helianthus annuus (common sunflower): 110899122
Entry
110899122         CDS       T05101                                 
Name
(RefSeq) beta-amyrin 28-monooxygenase
  KO
K22620  beta-amyrin 16beta-monooxygenase [EC:1.14.14.63]
Organism
han  Helianthus annuus (common sunflower)
Brite
KEGG Orthology (KO) [BR:han00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:han00199]
    110899122
Enzymes [BR:han01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.63  beta-amyrin 16beta-monooxygenase
     110899122
Cytochrome P450 [BR:han00199]
 Cytochrome P450, plant type
  CYP716 family
   110899122
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 110899122
NCBI-ProteinID: XP_022001693
Position
13:complement(122482056..122485166)
AA seq 500 aa
MQTQTHKPRATNTPIYSSSTMDTLFLLSSTLLPIITIFILHHLFSQKTTIPGSYGYPLLI
GESIDYFKKLRSGTNEKFVMQRRKLFGDVFKTSILGEKMAFLCGPEGNKFLFANENKLVE
VWWPSSVESIIKKSHNKSVTAESAKVRQLLPPFLRAHAVKNYVAGMDSELRQHLQDYWIG
RDQVEVCPFVAKYTFALAVKLLLGVRDPTELEKLAVPFVEAAGGIIAVPINIPGTRFNRG
VKASERIREVINGIIAQRRKDLADGTADPPQNLLSHMIVEVDKRNQDKNNAPTTDGDMSS
DLLGLLIGGYDTINTTVVFIMMMLVDYPDVYQRVLTEQMEVAKAKPTGELLNWDDLRKMK
YSWNVACEVLRMRPPTVGAFRVAKTDFTYAGFKIPKGWKLHYIPHYTQRNHEYFPHPEKF
DPSRFDGDGPAPYTYVPFGGGPRMCPGNEYARAEILVFMHNIITRYNWERLIPDEKVVID
PLPRPVYGLPIKLIPHKTEP
NT seq 1503 nt   +upstreamnt  +downstreamnt
atgcagacacaaactcacaaaccaagagccacaaacacccccatctattcttcctcaaca
atggacaccctattcctactttcttcaacacttttgcccatcatcaccatcttcattctg
caccatcttttctcccaaaaaacaaccattcccggaagctatggttatccactcctaata
ggagaaagcatagattacttcaaaaagctacgcagtggcacgaacgagaagttcgtcatg
caaagaagaaaactcttcggggatgttttcaaaacatcgattcttggtgagaaaatggcg
tttttatgtggcccagaagggaataagttcttgttcgctaatgaaaataagcttgttgaa
gtatggtggccgagttccgtggagagtattatcaagaaatctcacaataagtctgtaacc
gcggaatccgccaaggttcgacagctgttgccgccgttcttgagagctcacgcggttaag
aattatgtcgcgggtatggattcggagctcagacaacatttgcaggattactggattggg
cgtgatcaggttgaagtttgcccgttcgttgcaaaatacacatttgcattagccgtaaag
ttgctattgggagtgcgtgatccgacggagttggagaagcttgcggttccgttcgtggag
gcggccggtggaatcatagcggtcccgatcaacattccaggaacaaggtttaaccgtggc
gtcaaagcgtcagaaaggattcgtgaagttattaacggcataatcgcgcaaaggaggaaa
gatcttgccgacggaacagctgatccgccgcaaaatttgctttcgcacatgattgttgag
gttgacaaacggaatcaagacaagaacaacgctccgaccaccgacggtgacatgtccagt
gacttactagggttgctcatcggtggatatgacaccatcaacaccaccgtcgtgtttatt
atgatgatgcttgttgactaccccgatgtctaccaacgagttctaacagagcaaatggag
gtagcaaaggcgaaaccaacaggagaactgttaaactgggacgacctgcgcaagatgaag
tactcatggaacgtcgcatgtgaagtactgagaatgcgtccaccaaccgtcggcgcattc
cgtgtcgcgaaaaccgatttcacatatgccggtttcaaaatcccaaaaggatggaagcta
cattacattccacattacactcagcgaaaccacgagtacttcccacatcccgaaaagttt
gacccctcgagatttgacggagatggacccgcaccttacacatatgtgccgtttggtggt
ggtccgcgtatgtgccccggaaacgagtatgcacgagctgaaatactagtttttatgcac
aacataatcactagatacaattgggagaggctaattcctgatgaaaaagtggtgattgac
ccacttccaaggccagtttacgggcttccaattaagctcattcctcataaaacagaaccg
taa

DBGET integrated database retrieval system