KEGG   Helianthus annuus (common sunflower): 110901577
Entry
110901577         CDS       T05101                                 
Name
(RefSeq) beta-amyrin 28-monooxygenase
  KO
K22620  beta-amyrin 16beta-monooxygenase [EC:1.14.14.63]
Organism
han  Helianthus annuus (common sunflower)
Brite
KEGG Orthology (KO) [BR:han00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:han00199]
    110901577
Enzymes [BR:han01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.63  beta-amyrin 16beta-monooxygenase
     110901577
Cytochrome P450 [BR:han00199]
 Cytochrome P450, plant type
  CYP716 family
   110901577
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 110901577
NCBI-ProteinID: XP_022004085
Position
13:complement(122396553..122398803)
AA seq 479 aa
MDTLLLISSTLLPIITIFILYHFFTQKSSIPGHYGWPLIGESIDYFKKLRSGTNEQFAMQ
RRKLFGDVFGTSILGEKMAFLCGPEGNKFLFSNENKLVEVWWPSSVESIIKKSNNKSVTA
ESAKVRQLLPPFLRAHAVKNYIADMDSELRQHLEDYWTGRDQVEVCPFVAKYTFALAVKL
LLGVRDATELEKLAVPFVEAAGGIIAVPINIPGTRFNRGVKASKRIREVINGIIAQRRKD
LADGTADPSQNLLSHMIVEVDKRNQDTSNAPTTDGDMSSDLLGLLIGGYDTINTTVVFIM
MMLVDYPDVYREVLKEQTEIAKAKPSGELLNWDDLRKMKYSWNVACEVLRMRPPTVGAFR
VAKTDFTYGSFTIPKGWKLHYLPHYTQRNHEFFPHPEKFDPSRFEGAGPAPYTFVPFGGG
ARMCPGNEYARAEILVFMYNIVTRYNWERLIPDEKVVIDPLPRPVHGLPIKLIPHKTEA
NT seq 1440 nt   +upstreamnt  +downstreamnt
atggacaccctcctactaatctcttcaacacttttgcccatcatcaccatcttcattttg
taccattttttcacccaaaaatcatccattcccggacactatggctggccactcattggc
gaaagcatcgactacttcaagaagctccgcagcggcaccaacgagcagtttgccatgcaa
agaaggaaactattcggggacgtttttgggacgtccattcttggtgaaaaaatggcgttt
ttgtgtggcccagaagggaataagttcttgttttctaatgaaaacaagcttgttgaagtt
tggtggccgagttctgtggagagtattattaagaagtcgaataataagtctgtaaccgcg
gaatccgccaaggttcgacagctgttgccgccgttcttgagagctcatgctgttaagaat
tatattgctgatatggattcggagttgagacagcatttggaggattactggactggacgt
gatcaggttgaggtttgcccattcgttgcaaaatacacttttgcattggccgtaaagttg
ctactcggagtgcgtgatgctacggagttagagaagcttgcggttccgtttgtggaggcg
gcaggtggaatcatagcggttccgatcaacattccagggacaaggtttaaccgtggtgtc
aaagcgtcgaaaaggattcgcgaagtcattaatggcataatcgcacaaaggaggaaagat
cttgctgacggaactgctgatccgtcgcaaaatttgctctctcacatgattgtcgaggtt
gataagcgtaaccaggacacgagcaacgctccgacaaccgatggtgacatgtcgagtgac
ttactcgggttgttaataggtggttacgacaccatcaacacgaccgtcgtgttcattatg
atgatgcttgttgattacccggatgtctaccgagaggtcctaaaagagcaaaccgagata
gcaaaggcgaaaccatcgggtgaactactgaactgggacgacctacgcaaaatgaaatac
tcatggaatgtcgcgtgtgaagtgctaagaatgcgtccaccaactgtcggcgcattccgt
gtcgcgaaaaccgatttcacatacggcagtttcacaatccccaaaggatggaagctacat
taccttccacattacactcagcgaaaccacgaattcttcccgcatcccgagaagtttgac
ccctcgagatttgaaggagcgggacctgcaccttacacgtttgtgccgtttggtggcgga
gcgcgtatgtgtcccggaaacgagtatgcacgggccgaaatactggtgtttatgtacaac
atagtcactagatacaactgggagaggctaattcctgatgagaaagtggtaattgaccca
cttccaaggccagttcatgggcttccaattaagctcattcctcacaaaactgaagcttaa

DBGET integrated database retrieval system