KEGG   Hevea brasiliensis (rubber tree): 110638358
Entry
110638358         CDS       T05150                                 
Name
(RefSeq) delta(12)-acyl-lipid-desaturase-like
  KO
K21736  Delta12 acyl-lipid conjugase (11E,13E-forming) / acyl-lipid (9+3)-(E)-desaturase [EC:1.14.19.33 1.14.19.34]
Organism
hbr  Hevea brasiliensis (rubber tree)
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    110638358
Enzymes [BR:hbr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.33  Delta12 acyl-lipid conjugase (11E,13E-forming)
     110638358
    1.14.19.34  acyl-lipid (9+3)-(E)-desaturase
     110638358
SSDB
Motif
Pfam: FA_desaturase DUF3474
Other DBs
NCBI-GeneID: 110638358
NCBI-ProteinID: XP_021644600
Position
Unknown
AA seq 387 aa
MGGGSRMSAPIVSKKSDESKPAESLKRVPQTKPPFTLAQLKKAVPSHCFQRSLLRSFSYV
IFDISLSIIFLSVAISCFHLLPSPLTYFAWPLYWSLQGCILTGVWVIAHECGHHAFSDYQ
WVDDTVGFILHSALLVPYFSWKISHRRHHSNTGSLERDEVFVPKPKSRVPWYSKYLNNPL
GRGLTLAATLLIGWPLYLAFNVSGRPYDRFACHYDPYGPIYSDRERLQIFISDIGIFAAS
YVLYQIVMAKGLAWLICIYGVPLLIVNAFLVTITYLQHTHPALPHYNSSEWDWMRGALST
VDRDYGVLNKIFHNITDTHVVHHLFSTMPHYNAMEATKAIKHILGEYYQFDATPIYKALW
REAKECLYVEPDDGAPNQGVFWYRNKF
NT seq 1164 nt   +upstreamnt  +downstreamnt
atgggaggtggtagtcggatgtctgctcctatcgtcagcaagaaatccgatgaaagcaag
ccggctgagagccttaaacgagtaccccaaacaaaacctccattcacccttgcccaactt
aagaaagccgtcccttcccattgctttcaacgctcgcttcttcgctctttctcctatgtt
atcttcgacatctctttaagcattatcttcttatcggttgccatctcctgcttccatctc
ctcccttcccctctcacctacttcgcatggccgctctactggtctctccaaggttgcatt
ctcaccggtgtttgggtcattgcccatgaatgcggtcaccatgcttttagtgactatcag
tgggtggatgacactgttggcttcattcttcattctgcacttctagttccatatttttcc
tggaaaatcagccatcgccgccatcactctaacacagggtcacttgaacgtgatgaggtg
tttgttcctaaacccaagtccagagttccatggtattccaagtatctgaataacccacta
ggccgaggtttgacacttgcagccacgcttctcattgggtggcctttatacttagccttc
aatgtctcaggaagaccatatgatcgctttgcttgtcactatgatccctatggtcctatt
tattctgacagggaaaggcttcagatattcatttccgatattgggattttcgctgcaagt
tacgttctctatcaaattgtcatggcaaaaggtctggcttggttgatatgtatttatggg
gttccattgcttatcgtcaatgctttccttgtgaccatcacatacttgcagcacactcac
cctgcacttccacactataactcctctgaatgggactggatgaggggggctttgtcgact
gtggatcgtgactacggggtactgaacaagattttccataatattacagacacccacgta
gttcaccatctcttctccacaatgccacattataatgcaatggaggctaccaaagcaatc
aagcatatattgggtgagtattaccagtttgatgctactccaatttacaaagcattatgg
agggaggcaaaggagtgtctgtatgttgagccggacgatggagcccccaaccaaggtgtt
ttctggtatcggaacaagttttga

DBGET integrated database retrieval system