KEGG   Hydrogenobaculum sp. HO: HydHO_1415
Entry
HydHO_1415        CDS       T02482                                 

Definition
(GenBank) acetyl-CoA carboxylase, biotin carboxylase
  KO
K20141  2-oxoglutarate carboxylase small subunit [EC:6.4.1.7]
Organism
hho  Hydrogenobaculum sp. HO
Brite
KEGG Orthology (KO) [BR:hho00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HydHO_1415
Enzymes [BR:hho01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.7  2-oxoglutarate carboxylase
     HydHO_1415
SSDB
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp RimK GARS_A ATP-grasp_5 ATP-grasp_3 ATPgrasp_ST ATP-grasp_4
Other DBs
NCBI-ProteinID: AGG15724
UniProt: M1RLH2
Position
1342053..1343471
AA seq 472 aa
MFKKILVANRGEIACRIIRAAKELDIPTVAIYSEVEPTARHVKMADEAYMIGANPLDTYL
NAQLIVDLAKSVGADAIHPGYGFLAENEGFAELCEKNGITFIGPSAEVIALMGDKARSKE
VMKKAGVPTVPGSDGILKSVEEAIEIAKEIGYPVLLKASAGGGGRGIRICKDEEELKRNY
EAAYSEAQKAFGRGDLLLEKYIQNPKHIEFQVLGDKYGNVIHLGERDCSVQRRNQKLIEI
APSLVLNEAKRKHYGEIVAKAAKEIGYYSAGTMEFVSDLEGNIYFIEMNTRIQVEHPVTE
RVTGVDIVKEQIKIAAGHKLEIKQEDVTFNGYAIECRINAEDPKKNFAPSIGTIERYYVP
GGFGIRIESAASVGYEVTPYYDSLIAKLICWGRTWEEALSRTKAALDTYEIKGVKTTIPL
LKKIVEEKDFRNGYFTTKYLEEHQEVFNYEEPKDKEDFVAFISAAIASYHGL
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgtttaaaaagatattggtggcaaacagaggtgaaatagcttgtagaattataagagct
gcaaaagaacttgatatacccacagtagcaatatactctgaagtagagcctaccgccaga
cacgtgaagatggcagatgaagcttatatgataggtgcaaatcctcttgacacataccta
aacgctcaactcatagtggatttggcaaagtctgtgggggcagatgccatacatccagga
tatgggtttttggcagaaaacgaaggatttgcagagctttgtgaaaaaaatggtataacc
tttataggtccttctgccgaagtaatagcccttatgggtgataaggcaagatccaaagag
gtgatgaaaaaagcgggtgttcctacggtgcccggaagcgatggcatattaaaatctgta
gaagaggctattgaaatagcaaaagaaatagggtatccggtgcttttaaaagcctcagct
ggaggtggtggtagaggtattagaatatgtaaagacgaagaagagcttaaaagaaactat
gaagccgcttactctgaggctcaaaaagcctttggaagaggtgatttgcttttagaaaaa
tacattcaaaatccaaaacacatagagtttcaagtattaggtgataaatatggaaacgtt
atacatttaggggaaagggattgttctgtccaaagaagaaatcaaaaacttatagaaata
gctccttctttggtactaaacgaagcaaagagaaagcactacggtgaaatagtggcaaaa
gctgcaaaagagataggttattacagcgccggtaccatggaatttgtatctgacttagaa
ggtaacatatactttatagagatgaatacccgtattcaagtggaacaccctgtaacagaa
agagtgaccggtgttgatatagtaaaagagcaaataaagatagccgcaggtcataagctt
gagataaaacaagaggatgtaaccttcaacggatacgctatagaatgtcgtataaatgca
gaagatccaaagaaaaactttgctccaagcataggtactatagagcgttattacgtacct
ggtggttttggtattaggatagaaagtgcggcttctgtaggttacgaagttacgccatat
tatgactctttgatagcaaaacttatatgctggggtagaacttgggaagaggcactctca
aggacaaaggcagctttagacacttatgagataaagggtgttaaaaccacgatacctctt
cttaagaagattgtagaagaaaaagattttagaaatggatactttaccaccaagtatttg
gaagagcaccaagaggtgtttaattacgaagagccaaaagacaaagaagattttgtagct
tttataagtgcagctatagcttcatatcacgggttataa

DBGET integrated database retrieval system