KEGG   Helicobacter pylori PeCan4: HPPC_00375
Entry
HPPC_00375        CDS       T01322                                 

Gene name
lspA
Definition
(GenBank) lipoprotein signal peptidase
  KO
K03101  signal peptidase II [EC:3.4.23.36]
Organism
hpc  Helicobacter pylori PeCan4
Pathway
hpc03060  Protein export
Brite
KEGG Orthology (KO) [BR:hpc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    HPPC_00375 (lspA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hpc01002]
    HPPC_00375 (lspA)
Enzymes [BR:hpc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.36  signal peptidase II
     HPPC_00375 (lspA)
Peptidases and inhibitors [BR:hpc01002]
 Aspartic peptidases
  Family A8: signal peptidase II family
   HPPC_00375 (lspA)
Motif
Pfam: Peptidase_A8
Other DBs
NCBI-ProteinID: ADO06327
UniProt: E1Q3V5
Position
complement(70356..70829)
AA seq 157 aa
MLKTTKKSLLVFIGVFFLIFGVDQAIKYAILEGFRYESLMIDIVLVFNKGVAFSLLSFLE
GGLKYLQILLILGLFIFLMRQKELFKSHAIEFGMVFGAGVSNVLDRFVHGGVVDYVYYHY
GFDFAIFNFADVMIDVGVGVLLLRQFFFKQKQNKIKA
NT seq 474 nt   +upstreamnt  +downstreamnt
gtgctaaaaaccactaaaaaaagcctattggtttttataggggttttttttcttattttt
ggcgtggatcaagcgatcaaatacgctattttagaggggtttcgctatgaaagtttgatg
atagatattgttttggtgttcaataaaggcgtggcgttttccttgctcagttttttagag
gggggtttgaaatacttgcaaatccttttgattttagggctttttatctttttaatgcgc
caaaaggagctttttaaaagccatgccatagagtttggcatggtgtttggcgctggggtc
tctaatgttttagaccggtttgtgcatgggggcgtggtggattatgtgtattaccattat
gggtttgattttgccatttttaacttcgctgatgtcatgatagatgtgggtgtgggcgtt
ttattgttaagacaattcttttttaagcaaaaacaaaacaaaattaaggcataa

DBGET integrated database retrieval system