KEGG   Helicobacter pylori PeCan4: HPPC_01620
Entry
HPPC_01620        CDS       T01322                                 

Name
(GenBank) Sec-independent protein translocase protein tatA/E-like protein
  KO
K03116  sec-independent protein translocase protein TatA
Organism
hpc  Helicobacter pylori PeCan4
Pathway
hpc03060  Protein export
hpc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:hpc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    HPPC_01620
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    HPPC_01620
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hpc02044]
    HPPC_01620
Secretion system [BR:hpc02044]
 Twin-arginine translocation (Tat) system
  Twin-arginine translocation (Tat) pathway protein
   HPPC_01620
SSDB
Motif
Pfam: TatA_B_E Ni_hydr_CYTB DUF2956 DUF4179
Other DBs
NCBI-ProteinID: ADO06569
UniProt: E1Q578
Position
complement(322590..322829)
AA seq 79 aa
MGGFTSIWHWVIVLLVIVLLFGAKKIPELAKGLGSGIKNFKKAVKDDEEEAKNEPKTLDA
QAAQTKVHETSEIKSKQES
NT seq 240 nt   +upstreamnt  +downstreamnt
atgggcggattcacaagcatatggcattgggtcattgttttattagtgattgtgttgtta
tttggggctaaaaagatcccagagttggctaagggtttaggcagtgggattaaaaatttc
aaaaaagccgtaaaagacgatgaagaagaggctaaaaacgagccaaaaaccctagacgct
caagcagcacaaaccaaagtgcatgaaactagcgaaattaaaagcaaacaagaaagttaa

DBGET integrated database retrieval system