KEGG   Helicobacter pylori PeCan4: HPPC_01950
Entry
HPPC_01950        CDS       T01322                                 

Name
(GenBank) sec-independent translocase
  KO
K03117  sec-independent protein translocase protein TatB
Organism
hpc  Helicobacter pylori PeCan4
Pathway
hpc03060  Protein export
hpc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:hpc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    HPPC_01950
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    HPPC_01950
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hpc02044]
    HPPC_01950
Secretion system [BR:hpc02044]
 Twin-arginine translocation (Tat) system
  Twin-arginine translocation (Tat) pathway protein
   HPPC_01950
SSDB
Motif
Pfam: DUF3394 Fib_alpha TatA_B_E
Other DBs
NCBI-ProteinID: ADO06633
UniProt: E1Q5L8
Position
complement(384361..384843)
AA seq 160 aa
MFGMGFFEILVVLVVAIIFLGPEKFPQAVVDMVKFFRAVKKTLNDAKDTLDKEINIEEIK
KETLEYQKLFENKVESLKGIKIEELEDAKVTAENEIKSIQDLMQDYQQSLENNAPPNHSN
EEVSNEEALNEEISSDESPKEVKLATDNNTKEHDKEKEHV
NT seq 483 nt   +upstreamnt  +downstreamnt
atgtttggcatgggcttttttgaaatccttgtggtgttggttgtagcgattattttttta
gggccagaaaaattcccccaggctgtcgtggatatggtgaagtttttccgtgcggttaaa
aaaacgctcaatgacgctaaggatactttggataaagaaatcaatattgaagaaatcaaa
aaagaaaccctagagtaccaaaagctctttgaaaataaagtggagagtcttaagggcatt
aagattgaagaattagaagacgctaaagtaactgcagaaaatgagattaaaagcattcag
gacttgatgcaagattaccaacaaagcctagaaaacaacgcaccccctaaccattccaat
gaagaagtttccaatgaagaagccttaaatgaagaaatttcaagcgatgaatctcctaaa
gaagtcaaattagcaaccgataacaacaccaaagaacacgacaaagaaaaagagcatgtt
tga

DBGET integrated database retrieval system