KEGG   Helicobacter pylori PeCan4: HPPC_02580
Entry
HPPC_02580        CDS       T01322                                 

Name
(GenBank) virB11-like cag pathogenicity islandencoded protein / ATPase protein
  KO
K03196  type IV secretion system protein VirB11 [EC:7.4.2.8]
Organism
hpc  Helicobacter pylori PeCan4
Pathway
hpc03070  Bacterial secretion system
Module
hpc_M00564  Helicobacter pylori pathogenicity signature, cagA pathogenicity island
Brite
KEGG Orthology (KO) [BR:hpc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    HPPC_02580
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hpc02044]
    HPPC_02580
Enzymes [BR:hpc01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     HPPC_02580
Secretion system [BR:hpc02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   HPPC_02580
SSDB
Motif
Pfam: T2SSE ABC_tran DEAD AAA_7 FtsK_SpoIIIE ATP_bind_1 AAA_19 Mg_chelatase ResIII Pox_A32 AAA_22 AAA_16 TrwB_AAD_bind IPPT Septin DUF87 GARS_A AAA_30 HATPase_c_2 AAA_33 AAA_29 Zeta_toxin
Other DBs
NCBI-ProteinID: ADO06756
UniProt: E1Q613
Position
complement(506510..507502)
AA seq 330 aa
MTEDRLSAEDKKFLEVERALKEAALNPLRHATEELFGDFLKMENITEICYNGNKVVWVLK
NNGEWQPFDVRDRKAFSLSRLMHFARCCASFKKKTIDNYENPILSSNLANGERVQIVLSP
VTVNDETISISIRIPSKTTYPHSFFEEQGFYNLLDNKEQAISAIKDGIAIGKNVIVCGGT
GSGKTTYIKSIMEFIPKEERIISIEDTEEIVFKHHKNYTQLFFGGNITSADCLKSCLRMR
PDRIILGELRSSEAYDFYNVLCSGHKGTLTTLHAGSSEEAFIRLANMSSSNSAARNIKFE
SLIEGFKDLIDIVVHINHHKQCDEFYIKHR
NT seq 993 nt   +upstreamnt  +downstreamnt
atgactgaagacagattgagtgcagaagataaaaaatttctagaagtagaaagagcttta
aaagaagcggcattaaatcctctaaggcatgctactgaagaactttttggtgatttttta
aaaatggaaaatatcactgagatttgttacaatgggaacaaggttgtatgggttttaaaa
aataatggcgaatggcaaccatttgatgtgagagacaggaaagcctttagtttgtctcgt
ttaatgcattttgctcggtgttgtgcaagttttaagaaaaaaacaatagacaactatgaa
aatcctattttgagcagcaatttagcgaatggtgaaagggtgcagattgtcctttcccct
gttacagttaatgatgaaaccatttccatatccataaggatacctagcaaaacaacctat
cctcatagcttctttgaagagcagggtttttataatctactagataacaaagaacaagcg
atcagtgcgattaaagatggtattgctattggtaaaaatgtgattgtttgtggtggcaca
ggaagcggtaaaacgacttatatcaaaagcatcatggagtttatccccaaagaagaaagg
atcatatccattgaagacaccgaagagattgtattcaaacaccacaagaactacacacag
cttttttttggtgggaatatcacctctgctgattgcttaaagtcatgtctgagaatgcgg
cctgatagaatcattttaggggaactcagaagcagtgaggcatacgatttttataatgtg
ctttgtagcggtcataaaggcacgctaaccactctgcatgcagggagcagtgaagaagcg
tttatccgtttagccaacatgagttcatctaatagcgcagcaaggaatatcaagtttgaa
agcctcattgaaggctttaaagatttgattgatatagttgttcatatcaaccaccacaaa
cagtgtgatgaattttatatcaaacataggtag

KEGG   Helicobacter pylori PeCan4: HPPC_06915
Entry
HPPC_06915        CDS       T01322                                 

Name
(GenBank) putative type IV secretion system ATPase
  KO
K03196  type IV secretion system protein VirB11 [EC:7.4.2.8]
Organism
hpc  Helicobacter pylori PeCan4
Pathway
hpc03070  Bacterial secretion system
Module
hpc_M00564  Helicobacter pylori pathogenicity signature, cagA pathogenicity island
Brite
KEGG Orthology (KO) [BR:hpc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    HPPC_06915
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hpc02044]
    HPPC_06915
Enzymes [BR:hpc01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     HPPC_06915
Secretion system [BR:hpc02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   HPPC_06915
SSDB
Motif
Pfam: T2SSE AAA_16 AAA_29 AAA_23 MMR_HSR1 SRPRB ABC_tran RsgA_GTPase Dynamin_N DEAD AAA_7 FtsK_SpoIIIE DUF815 cobW AAA_35 Zeta_toxin
Other DBs
NCBI-ProteinID: ADO07591
UniProt: E1Q4G3
Position
complement(1384223..1385137)
AA seq 304 aa
METLQTHRVLQALISHFTPFLESGITELIINTEQELWLYKINNTREKRGHALFDKAFLLR
FCEQLASFRGLFFDEEHPTLNCSIPFTRYRVSANHFSITTNNQITLNIRVPRLKPLSLDD
FTFKASDPEGLKDLALKGHNILISGETSSGKTSLLNALLDCVNKDERVVSVEDSQELDLK
AFSNCVGLLVGKQENTRFNYEDALNMAMRLNPDRLIVGEIDTRNAALFLRLGNTGHKGML
STIHANSAQNTLEALSLNLSMRYTHSLDKDLMRAYFRSAIDVIVHVNRINNERQIAEVLW
TKEL
NT seq 915 nt   +upstreamnt  +downstreamnt
ttggaaactttacaaacccatagagttttacaagccctaattagccattttacccctttt
ttagaaagcgggatcacagagctgataatcaataccgagcaggagctttggctttataaa
atcaataacacacgagaaaaaagagggcatgcgctttttgataaggcgtttttgctgaga
ttttgcgagcaactggctagttttagggggttgttttttgatgaagagcaccccacttta
aattgctctatccctttcacgcgctatagggtgagcgcgaatcactttagcatcactacc
aataatcaaatcacgctcaatatccgtgtgcctaggcttaagcccttaagtttagacgat
ttcactttcaaagcaagcgatccagaaggtttgaaagatttagccctaaaagggcataac
attctcattagcggggagacttcaagcggtaaaacaagcctattaaacgctcttttagat
tgcgtcaataaagatgaaagggtggtgagcgttgaagacagccaagaattggatttaaaa
gcgtttagtaattgcgtggggcttttagtgggcaagcaagaaaacacgcgctttaattat
gaagacgctctcaatatggccatgcgcttaaatccggacaggctcattgtaggcgagatt
gacaccaggaatgcagcgctttttttgcgtttaggaaacactgggcataagggcatgctc
tcaaccattcatgctaatagcgctcaaaacactttagaagccctttcgttgaatttaagc
atgcgttatacgcattctttggataaggatttaatgcgagcgtattttagaagcgcgatt
gatgtgatcgtgcatgtgaataggatcaacaatgagcgccaaatcgctgaagtcttatgg
actaaagagctttaa

KEGG   Helicobacter pylori PeCan4: HPPC_07735
Entry
HPPC_07735        CDS       T01322                                 

Name
(GenBank) VirB11 type IV secretion ATPase
  KO
K03196  type IV secretion system protein VirB11 [EC:7.4.2.8]
Organism
hpc  Helicobacter pylori PeCan4
Pathway
hpc03070  Bacterial secretion system
Module
hpc_M00564  Helicobacter pylori pathogenicity signature, cagA pathogenicity island
Brite
KEGG Orthology (KO) [BR:hpc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    HPPC_07735
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hpc02044]
    HPPC_07735
Enzymes [BR:hpc01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     HPPC_07735
Secretion system [BR:hpc02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   HPPC_07735
SSDB
Motif
Pfam: T2SSE AAA_7 SRPRB FtsK_SpoIIIE AAA_16 T4_baseplate Pox_A32 Zeta_toxin AAA_29 DUF463 TsaE
Other DBs
NCBI-ProteinID: ADO07751
UniProt: E1Q5C8
Position
1549767..1550708
AA seq 313 aa
MISNLLKSYLDDFMPILSQPNLNEVVFNKEKEYFLHRPKEKVRCFNEKFTNDYLLVFCEQ
LAIFRNQKFTLKTPKLNTSLPYTQIRINALHPSIIASSNISINIRVPSNFKFEINAFKLS
EKCLAKNITYDFLLSLVSSGKNILISGGTASGKTSFVNSLIENIPKNERVVTIEDSPELK
ISNEDQVNILVDKSGSGFFTYEDGLNAAMRMSPDRLLLGEIDTHNTALFLRLANTGHSGM
ISTLHANSVVDAFIAICQNINLNKGGKPTPKETLLDYFCTGMDYVIQIKKKGSDRIIDDV
LNVKSEFKKELVL
NT seq 942 nt   +upstreamnt  +downstreamnt
atgatttctaatcttttaaaaagttaccttgatgactttatgcctattttaagccaacct
aatttaaatgaagtggtttttaataaagaaaaagagtattttttgcaccgcccaaaagaa
aaagtgaggtgttttaatgaaaaatttactaacgattatttgttggttttctgtgagcaa
ttagccatttttagaaaccaaaaattcactctaaaaacgcctaagttaaacacttctttg
ccttacacgcaaattagaattaacgcattacaccctagcattattgctagttctaatatc
tctatcaatattagagtgcctagcaatttcaagtttgaaattaacgcctttaaattaagt
gagaaatgtctggctaaaaacattacctatgattttttacttagcttagtaagctcaggt
aaaaatatcttaattagtggtggcacagctagcggtaaaactagctttgttaattccttg
attgaaaatattcccaaaaacgaaagggtggttactattgaagatagtcctgaattaaaa
atcagtaatgaagatcaagtcaatattttagtggataaaagcgggagcgggtttttcact
tatgaagatggcttaaatgcggctatgagaatgtctcctgatagattattattaggcgaa
attgacacgcataacactgcgttatttttgcgtttagcaaataccgggcatagcggaatg
ataagcaccttacacgccaatagtgtggtagatgcttttatagctatttgtcagaatatc
aacttgaataaaggcggtaagcctacccctaaagaaacgcttttagattatttttgcact
ggtatggactatgttatccaaatcaaaaaaaaaggtagcgataggataattgatgatgtt
ttaaatgttaaaagcgaatttaaaaaggagttggtgttatga

DBGET integrated database retrieval system