KEGG   Helicobacter pylori PeCan4: HPPC_02855
Entry
HPPC_02855        CDS       T01322                                 

Definition
(GenBank) signal peptidase I (lepB)
  KO
K03100  signal peptidase I [EC:3.4.21.89]
Organism
hpc  Helicobacter pylori PeCan4
Pathway
hpc03060  Protein export
Brite
KEGG Orthology (KO) [BR:hpc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    HPPC_02855
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hpc01002]
    HPPC_02855
Enzymes [BR:hpc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.89  signal peptidase I
     HPPC_02855
Peptidases and inhibitors [BR:hpc01002]
 Serine peptidases
  Family S26: signal peptidase I family
   HPPC_02855
Motif
Pfam: Peptidase_S26
Other DBs
NCBI-ProteinID: ADO06809
UniProt: E1Q666
Position
complement(560590..561462)
AA seq 290 aa
MKFLRSVYAFCSSWVGTIIIVLLVIFFVAQAFIIPSRSMVGTLYEGDMLFVKKFSYGIPI
PKIPWIELPVMPDFKNNGHLIEGDRPKRGEVVVFIPPHEKKSYYVKRNFAIGGDEVLFTN
EGLYLHPFESDTDKNYIAKHYPNAMTKEFMGKIFVLNPYKNEHPGIHYQKDNETFHLMEQ
LATQGAEANISMQLIQMEGEKVFYKKINNDEFFMIGDNRDNSSDSRFWGSVAYKNIVGSP
WIVYFSLSLKNSLEMDAENNPKKRYLVRWERMFKSVEGLEKIIKKEKATP
NT seq 873 nt   +upstreamnt  +downstreamnt
atgaaatttttacgctctgtttatgcgttttgctccagttgggtagggacgattattatt
gtgctgttggttatcttttttgtcgcgcaagcctttatcattccctctcgctctatggta
ggcacgctctatgagggcgatatgctctttgtcaaaaagttttcttacggcatacccatt
cctaaaatcccatggattgagctccctgttatgcctgattttaaaaataacgggcatttg
atagagggggatcgccctaagcgcggcgaagtggtggtgtttatccctccccatgaaaaa
aaatcttactatgtcaaaaggaattttgccattggaggcgatgaggtgttattcactaat
gaggggctttatttgcacccttttgagagcgacacagacaaaaattacattgctaaacat
taccctaacgccatgactaaagaatttatgggtaaaatttttgttttgaacccctataaa
aatgagcatccgggtatccattaccaaaaagacaatgaaaccttccacttaatggagcag
ttagccactcaaggcgcagaagctaatatcagcatgcaactcattcaaatggagggcgaa
aaggtgttttacaaaaaaatcaataacgatgaatttttcatgatcggcgataacagagat
aattctagcgactcgcgcttttgggggagtgtggcttataaaaacatcgtgggttcgcca
tggattgtttatttcagtttgagtttaaaaaatagcttggaaatggacgcagaaaataac
cccaaaaaacgctatctggtgcgttgggagcgcatgtttaaaagcgttgaaggcttagaa
aaaatcattaaaaaagaaaaagcaacgccttaa

DBGET integrated database retrieval system