KEGG   Helicobacter pylori PeCan4: HPPC_03865
Entry
HPPC_03865        CDS       T01322                                 

Name
(GenBank) cell division protein (ftsY)
  KO
K03110  fused signal recognition particle receptor
Organism
hpc  Helicobacter pylori PeCan4
Pathway
hpc02024  Quorum sensing
hpc03060  Protein export
hpc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:hpc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    HPPC_03865
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    HPPC_03865
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    HPPC_03865
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hpc02044]
    HPPC_03865
Secretion system [BR:hpc02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   HPPC_03865
SSDB
Motif
Pfam: SRP54 AAA_30 Zeta_toxin AAA_17 ABC_tran AAA_22 AAA_16 cobW AAA_27 CbiA APS_kinase AAA_33 AAA_24 Viral_helicase1 AAA_29 DUF2075 SRP54_N AAA_14 AAA_19 Arf AAA_23 Thymidylate_kin ADK AAA_13
Other DBs
NCBI-ProteinID: ADO06999
UniProt: E1Q6Q6
Position
775108..775986
AA seq 292 aa
MFNFFKKIVNKIKGEEKEKKRENIPKEELEEILIGFDIQYDLIESLLNHLGDLITPKQLE
VALLRFVRGESYYDKTRLKTITTKPLVHLIVGVNGAGKTTTIAKLAKLSLKQHKKALLGA
GDTFRAAAVKQLQLWGEKLNIQVISAKEGSDPSSLAYNTIESAIAKNIDEVFIDTAGRLH
NQTNLKNELSKIARTCSKVLKDAPFYKFLILDGTQGSSGLTQAKIFHETLALDGVIMTKL
DGTSKGGAILSVLYELKLPILYLGMGEKEDDLIAFDEERFIEDLVDAVFVEQ
NT seq 879 nt   +upstreamnt  +downstreamnt
atgtttaattttttcaaaaaaattgtcaataagattaagggcgaagagaaagaaaaaaag
cgtgaaaatattcctaaagaggaattagaagaaattttgattggctttgacattcaatac
gatttgatagagagcttgttaaatcatttaggcgatttaatcacgcccaagcaattagaa
gtcgctttgttgcgttttgtgcgtggggaaagctattatgataaaacacgcctaaaaacc
atcaccacaaaacccttagtgcatttaatcgtgggggttaatggggcgggcaaaaccaca
acgatcgccaaactcgccaagctctctttaaaacagcataaaaaagcgcttttaggggca
ggcgatacctttagagcggccgcagtcaaacagctccagttatggggcgaaaagcttaac
attcaagtcattagcgctaaagaagggagcgatccaagctctctagcttataacaccata
gaaagcgctatcgctaaaaatatagatgaagtttttatagacaccgccgggaggttacac
aaccagaccaaccttaaaaacgagctttctaaaatcgcgcgcacctgctctaaagtttta
aaagacgcccccttttataaattccttattttagacggcacgcaagggagctctgggctc
actcaagccaagatttttcatgagactttggcgttagacggcgtgattatgactaagctt
gatggcacttctaaaggcggagcgattttaagcgtgctgtatgagttgaaattacccatt
ctttatttaggaatgggcgaaaaagaagacgatttgatcgcttttgatgaagaacgcttt
atagaagatttggttgatgcggtgtttgtggaacaataa

DBGET integrated database retrieval system