KEGG   Helicobacter pylori PeCan4: HPPC_03970
Entry
HPPC_03970        CDS       T01322                                 

Name
(GenBank) preprotein translocase subunit SecA
  KO
K03070  preprotein translocase subunit SecA [EC:7.4.2.8]
Organism
hpc  Helicobacter pylori PeCan4
Pathway
hpc02024  Quorum sensing
hpc03060  Protein export
hpc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:hpc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    HPPC_03970
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    HPPC_03970
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    HPPC_03970
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hpc02044]
    HPPC_03970
Enzymes [BR:hpc01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     HPPC_03970
Secretion system [BR:hpc02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   HPPC_03970
SSDB
Motif
Pfam: SecA_DEAD SecA_SW SecA_PP_bind SEC-C DEAD Helicase_C DUF6429 ResIII
Other DBs
NCBI-ProteinID: ADO07020
UniProt: E1Q6S7
Position
797898..800495
AA seq 865 aa
MIKAIIGKIIGTRNDRWIKQYKKKVLAINALEPTYEKMSDIELQNAFEELKKRVRSTEKD
LQEKTLLEVLPESFAITREASKRILKMRHFDVQLIGGMVLNDGKIAEMKTGEGKTLVATL
AVALNAMKGESVYVVTVNDYLAHRDSKEMEPLYQFLGYSVGTITASVRDDDERLEIYSKD
IVYGTNNEFGFDYLRDNMKYSLEHKVQKSHAFAIVDEVDSILIDEARTPLIISGPVDRRM
ENYNKADEVAKSMQVETDFTIDEKNRAILITEEGIKKAENLFGVDNLYKIENAALSHHLD
QALKANYLFFVDKDYIVANNEVVIVDEFTGRLSEGRRFSEGLHQALEAKEGVSIKEESQT
LADITFQNYFRMFSKLSGMTGTAQTEATEFLEIYNLEVVSIPTNLAIKRKDLNDLIYKSE
KEKFDAVILKIKELHDKGQPVLVGTASIEKSETLHALLKKERIPHTVLNAKQHTKEAEII
KDAGLKGAVTIATNMAGRGVDIKLTDEVKELGGLYIIGTERHESRRIDNQLRGRSGRQGD
PGTSQFYLSLEDNLLRIFGSDRIKGVMEKLGLKDGEHIESKLVTRAVENAQKKVENLHFE
SRKHLLEYDDVANEQRKSVYKFRDELLDANYDIGAKIAENREYALNQIFSKLKAFDHQNL
SEEELLGLKNILKEDFNAHVALEDLEKASPIEKFVAEKLKSDYENKMKVLDSEQRSRIER
IVYLQILDNAWREHLYTMDNLKTGINLRGYNQKDPLVEYKKESYNLFLELIEDIKMEAIK
TFSKIQFEDEQDSSDAERYLDNFSEEREHESVTYRHEETLDEDLNVAMKAFAKTPKRNEP
CPCGSGKKYKDCCAKSGPKKGLFAK
NT seq 2598 nt   +upstreamnt  +downstreamnt
atgataaaagcaatcattggaaaaatcattggcaccagaaacgatcgctggatcaaacaa
tacaaaaaaaaagtcctagccatcaacgccttagagcctacttatgaaaaaatgagcgat
attgagctgcaaaacgcttttgaagaattaaaaaaacgcgtgcgatccacagaaaaagat
ttgcaagaaaaaacccttttagaagtccttcctgaaagttttgctatcaccagagaagcg
agcaaaaggatcttaaagatgcgccattttgacgtgcagctcattgggggcatggtttta
aacgatggcaaaatcgctgaaatgaaaaccggagagggtaaaactttagtcgctacttta
gcggtggctttgaacgctatgaagggtgaaagcgtgtatgtggtaacggtcaatgattac
ctagcccatagggactctaaagaaatggagccattgtatcaattcttaggttatagcgta
ggcacgatcactgcgagcgtgcgagatgatgatgagcgcttagaaatttattctaaagac
attgtttatggcactaataatgaatttggctttgattatctaagggataacatgaaatat
tctttagagcataaagtgcaaaaatcgcatgcgttcgctattgttgatgaggtggattcc
attttaattgatgaagcgagaacccctttaatcatttcagggcctgtggataggcgcatg
gaaaattacaacaaggctgatgaagtcgctaaaagcatgcaagtggaaaccgatttcacc
atagatgaaaaaaaccgcgcgattttgatcactgaagaggggattaaaaaagccgaaaac
ctctttggcgtggataatttatacaagattgaaaacgccgccttatcgcaccatttagac
caggctttgaaagcgaattacctcttttttgttgataaagattatattgtagccaataat
gaagtggtgattgtagatgaatttaccggccgcttgtctgaggggagacgctttagtgag
ggcctgcatcaggctttagaggctaaagagggcgtgagcattaaagaagagagccaaacc
ttagccgatattactttccaaaattatttcaggatgttttctaaactttcaggcatgaca
ggtacggctcaaaccgaagccacagaatttttagaaatctacaatttagaagtggtgtct
atccctactaatctagcgatcaagcgaaaagacttgaacgatctcatctataagagtgaa
aaagaaaaatttgacgccgtgatccttaaaattaaagaattgcacgataaggggcagccc
gttttagttggcacggctagcattgaaaaaagtgaaaccttgcacgctttactcaaaaaa
gaacgcatccctcacaccgttttaaacgccaagcagcacaccaaagaagctgaaatcatc
aaagacgccgggcttaaaggggcggttacgattgcgactaacatggcagggaggggcgtt
gatattaaactcaccgatgaggttaaagagcttggggggctgtatatcattggcactgaa
aggcatgagagccgcaggattgataaccaattaagggggcgaagcgggcgccagggcgat
ccgggaacaagtcagttttatttgagtttagaagacaatctgttacgcatttttgggagc
gataggattaagggggtgatggaaaaattagggcttaaagacggcgaacacattgaatca
aagcttgttacaagagcggtggaaaacgcgcaaaaaaaagtggagaatttgcattttgaa
agccgtaagcatttgttagaatacgatgatgtggctaatgagcaacgaaaaagcgtgtat
aaatttagagatgaattattagatgccaattacgatattggcgctaaaatcgctgaaaac
agagaatacgcgctcaatcaaatcttttctaaactcaaagcctttgaccatcaaaacctg
tctgaagaggaacttttagggcttaaaaacatcttaaaagaagattttaacgctcatgtt
gcattagaagatttagaaaaagcctcccctattgaaaagtttgtggctgaaaaattaaaa
agcgattatgaaaacaaaatgaaagttttggacagcgaacaaagaagccggatcgaacgc
atcgtgtatttgcagattttagacaacgcatggcgagagcacctttatacgatggataat
ctcaaaaccggtattaatttaagaggctataaccaaaaagaccctcttgtagaatacaaa
aaagagagttacaaccttttcttagaactcattgaagacattaaaatggaagcgatcaaa
accttttctaagatccagtttgaagatgagcaagattctagcgatgcggagcgttatttg
gataactttagcgaagaaagagagcatgagagcgtaacttaccgccatgaagaaacttta
gatgaagatttgaatgtggccatgaaagctttcgctaaaacccctaaaaggaacgagcct
tgcccttgtgggagtggcaaaaaatataaagattgttgcgctaaaagcgggcctaaaaag
ggcttatttgccaaatag

DBGET integrated database retrieval system