KEGG   Helicobacter pylori PeCan4: HPPC_04470
Entry
HPPC_04470        CDS       T01322                                 

Name
(GenBank) vacuolating cytotoxin A
  KO
K11028  vacuolating cytotoxin
Organism
hpc  Helicobacter pylori PeCan4
Pathway
hpc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:hpc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    HPPC_04470
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hpc02000]
    HPPC_04470
   02044 Secretion system [BR:hpc02044]
    HPPC_04470
   02042 Bacterial toxins [BR:hpc02042]
    HPPC_04470
Transporters [BR:hpc02000]
 Other transporters
  Pores ion channels [TC:1]
   HPPC_04470
Secretion system [BR:hpc02044]
 Type V secretion system
  Autotransporter-1 (AT-1) family
   HPPC_04470
Bacterial toxins [BR:hpc02042]
 Type III toxins: Intracellular toxins
  Others
   Vacuolating cytotoxin
    HPPC_04470
 Type II toxins: Membrane damaging toxins
  Pore-forming toxins, Other
   HPPC_04470
SSDB
Motif
Pfam: VacA
Other DBs
NCBI-ProteinID: ADO07116
UniProt: E1Q2L8
Position
897281..901156
AA seq 1291 aa
MEIQQTHRKMNRPLVSLALVGALVSITPQQSHAAFFTTVIIPAIVGGIATGTAVGTVSGL
LGWGLKQAEEANKTPDKPDKVWRIQAGKGFNEFPNKEYDLYQSLLSSKIDGGWDWGNAAR
HYWVKGGQWNKLEVDMKDAVGTYKLSGLRNFTGGDLDVNMQKATLRLGQFNGNSFTSYKD
SADRTTRVDFNAKNISIDNFVEINNRVGSGAGRKASSTVLTLQASEGITSDKNAEISLYD
GATLNLASSSVKLMGNVWMGRLQYVGAYLAPSYSTINTSKVTGEVDFNHLTVGDQNAAQA
GIIASNKTHIGTLDLWQSAGLNIIAPPEGGYKDKPKDKPSNTTQNNANNNQQNSAQNNSN
TQVINPPNSAQKTEIQPTQVIDGPFAGGKNTVVNIDRINTNADGTIRVGGFKASLTTNAA
HLHIGKGGVNLSNQASGRSLLVENLTGNITVDGPLRVNNQVGGYALAGSSANFEFKAGTD
TKNGTATFNNDISLGRFVNLKVDAHTANFKGIDTGNGGFNTLDFSGVTDKVNINKLITAS
TNVAVKNFNINELIVKTNGVSVGEYTHFSEDIGSQSRINTVRLETGTRSIFSGGVKFKGG
EKLVIDEFYYSPWNYFDARNIKNVEITRKFASSTPENPWGTSKLMFNNLTLGQNAVMDYS
QFSNVTIQGDFINNQGTINYLVRGGQVATLNVGNAAAMMFNNDIDSATGFYKPLIKINSA
QDLIKNTEHVLLKAKIIGYGNVSTGTNGISNVNLEEQFKERLALYNNNNRMDTCVVRDLN
DVKACGMAIGNNDMVNNPSSYNYLVGKAWKNIGISKTANGSKISVRYLGNSTPTENGGNT
TTLPTNTTNKARSASYALIKNAPFAQASATPNLVAINKHDFGTIESVFELANRSKDIDTL
YANSGAQGRDLLQTLLIDSHNAGYARTMIDATSTNEITKQLNEANSALNNIASLDHKTSG
LQTLSLSNAMILNSRLVNLSRRHTNNIDSFAKRLQALKGQRFASLESAAEVLYQFAPKYE
KPTNVWANAIGGASLNSGSNASLYGTSAGVDAYLNGEVEAIVGGFGSYGYSSFSNQANSL
NSGANNTNFGVYSRIFANQHEFDFEAQGALGSDQSSLNFKSALLRDLNQSYNYLAYSATA
RASYGYDFAFFRNALVLKPSVGVSYNHLGSTNFKSNSNQKVALKNGSSSQHLFNANANVE
ARYYYGDTSYFYLHAGVLQEFAHFGSNDVASLNTFKINAARNPLSTHARVMMGGELQLAK
EVFLNLGFVYLHNLISNIGYFASNLGMRYSF
NT seq 3876 nt   +upstreamnt  +downstreamnt
atggaaatacaacaaacacaccgcaaaatgaatcgccctctggtttctctcgctttagtg
ggagcattggtcagcatcacaccgcaacaaagtcatgccgcctttttcacaaccgtgatc
attccagccattgttgggggtatcgccacaggcaccgctgtaggaacggtctcagggctt
cttggctgggggctcaaacaagccgaagaagccaataaaaccccagataaacccgataaa
gtttggcgcattcaagcaggaaaaggctttaatgaattccctaacaaggaatacgactta
taccaatcccttttatccagtaaaattgatggaggttgggactgggggaacgccgctagg
cattattgggtcaaaggcgggcaatggaataagcttgaagtggatatgaaagacgctgta
gggacttataaactatcaggtcttagaaactttactggtggggatttagacgtgaatatg
caaaaagccactttgcgtttgggtcaattcaatggcaattcttttacaagctataaggat
agcgctgatcgcaccacgagagtggatttcaacgctaaaaatatctcaattgataatttt
gtagaaatcaacaatcgtgtgggttctggagccggaaggaaagccagctctacggttttg
actttgcaagcttcagaagggatcactagcgataaaaacgctgaaatttctctttatgat
ggcgccacgctcaatttggcttcaagcagcgttaaattaatgggtaatgtgtggatgggt
cgtttgcaatacgtgggagcgtatttggccccttcatacagcacgatcaacacttcaaaa
gtaacaggggaagtggattttaaccatctcactgtgggggatcaaaacgccgctcaagcg
ggcattatcgctagcaataagactcatattggcacattggatttgtggcaaagcgcgggg
ctaaacattatcgctcctcccgaaggtggttataaggataaacctaaggataaacctagt
aacaccacgcaaaataatgctaacaacaaccaacaaaacagcgctcaaaacaatagtaac
actcaggtcattaacccacccaatagcgcgcaaaaaacagaaattcaacccacacaagtc
attgatgggccttttgcgggtggcaaaaacacggttgtcaatattgatcgcatcaacact
aacgctgatggcacgattagagtgggagggtttaaagcttctcttaccaccaatgcggct
catttgcatatcggcaaaggcggtgtcaatctgtccaatcaagcgagcgggcgctctctt
ttagtggaaaatctaactgggaatatcaccgttgatgggcctttaagagtgaataatcaa
gtgggtggctatgctttggcaggatcaagcgcgaattttgagtttaaggctggtacggat
accaaaaacggcacagccacttttaataacgatattagtctgggaagatttgtgaattta
aaggtggatgctcatacagctaattttaaaggtattgatacgggtaatggtggtttcaac
accttagattttagtggcgttacagacaaagtcaatatcaacaagctcatcacagcttcc
actaatgtggccgttaaaaacttcaacattaatgaattgattgttaaaaccaatggtgtg
agtgtgggggaatacactcattttagcgaagatataggcagtcaatcgcgcatcaacacc
gtgcgtttggaaactggcactaggtcaatcttttctgggggtgttaaatttaaaggcggt
gaaaaactggttatagatgagttttactatagcccttggaattattttgacgctaggaat
attaaaaatgttgaaatcaccagaaaattcgcttcttcaaccccagaaaacccttggggc
acatcaaagcttatgtttaataatctaaccctaggtcaaaatgcagtcatggattatagt
caattttcaaatgtaaccattcagggggattttatcaacaatcaaggcactatcaactat
ctggtccgaggtgggcaagtggcaaccttaaatgtaggcaatgcagcagctatgatgttt
aataatgatatagacagcgcgaccggattttacaaaccgctcatcaagattaacagcgct
caagatctcattaaaaatacagagcatgttttattgaaagcgaaaatcattggttatggt
aatgtttctacaggtaccaatggcattagtaatgttaatctagaagagcaattcaaagag
cgcctagccctttataacaacaataaccgcatggatacttgtgtggtgcgcgatctcaat
gatgttaaagcatgcgggatggctatcggcaataatgatatggtgaataaccctagcagt
tataactaccttgtgggtaaagcatggaagaatatagggatcagcaaaacagctaacggc
tctaaaatttcggtgcgttatttaggcaattctacgcctactgagaatggtggcaatacc
acaactttacctacaaacaccaccaacaaggcgcgttccgctagctacgctctcataaag
aacgctcccttcgctcaagctagcgccactcctaatttagtcgctatcaataagcatgat
tttggcaccattgaaagcgtgtttgaattggctaaccgctctaaggatattgacacgctt
tatgctaactcaggtgcgcaaggtagggatctcttacaaaccttattgattgatagccac
aatgcgggttatgcaagaacaatgattgatgctacaagcactaatgaaatcaccaagcaa
ttgaatgaagccaatagcgctttaaacaacatagccagtttggatcataagacaagcggc
ttgcaaactttgagcttgagcaatgcgatgattttaaattctcgtttagtcaatctctcc
agaaggcacaccaacaatattgactcgttcgccaaacgcttgcaagctttaaaaggccaa
agattcgcttctttagaaagcgctgcagaagtgttgtatcaatttgcccccaaatatgaa
aaacccaccaatgtttgggctaacgctattgggggagcgagcttgaatagcggctctaac
gcttcattgtatggcacaagcgccggcgtagacgcttaccttaacggggaagtggaagcc
attgtaggcgggtttggaagctatggttatagctcctttagcaatcaagcgaactctctt
aactctggggccaataacactaattttggcgtgtatagccgtatttttgctaaccagcat
gaatttgattttgaagctcaaggggcgctagggagtgatcaatcaagcttgaatttcaaa
agcgctctactgcgagatttgaatcaaagctataattacttagcctatagcgccacagca
agagcgagctatggttatgactttgcgttttttaggaacgctttggtgttaaaaccaagc
gtgggcgtgagctataaccatttaggctcaaccaactttaaaagcaacagcaatcaaaaa
gtggctttgaaaaatggctctagcagtcagcatttattcaacgctaacgctaatgtggaa
gcgcgttattattatggggacacttcatacttctatttgcatgcgggagttttacaagag
ttcgctcactttggatcgaatgatgtggcgtctttaaacacctttaaaatcaatgccgct
cgcaaccctttaagcacccatgcaagagtgatgatgggtggggaattgcaattagctaaa
gaagtgtttttgaatttgggctttgtttatttgcacaacttgatttccaatataggctat
ttcgcttccaatttaggaatgaggtatagtttctaa

DBGET integrated database retrieval system